Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|112890
Gene name
Locationscaffold_8:1781309..1782662
Strand-
Gene length (bp)1353
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 3.8E-11 86 228

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|112890
MFGFRFGTLALLFSAMCTQSLAMPALGNVTSTSPELSMEMFKRAVSAPYVFTAFTSSSESNLYVYTSDDGTDFRL
LKGPTYTPPSGLIRDPSVILHTDGNYYIAYTTDWTGTNFAIASSSNLINWTRLATISTASSVITPVNTWAPEFFK
DPRTGKLNIIVSLSTGSFGPFLPYVFTASDSTLRSWSGPVRMSGISNAGLGYIDTFPLFHNNQYHIFTKAESNGK
KHIEHAVATSLTGPYSFVQTGDFAGWGQAEGPCVTVLPNGRFRLYADGFSSGKYITADSSDLFNWTPFQTIPGLS
GVVRHGTVLKQ*
Coding >AgabiH97|112890
ATGTTCGGTTTCAGATTCGGCACTTTGGCTCTACTTTTTAGTGCAATGTGCACTCAGAGTCTCGCTATGCCTGCT
CTAGGCAACGTGACCTCTACAAGCCCAGAATTATCGATGGAGATGTTTAAACGGGCCGTGTCTGCTCCCTATGTT
TTCACCGCCTTCACTTCTTCATCTGAATCCAACCTCTACGTTTATACCTCGGATGACGGAACGGATTTCAGGTTG
TTAAAAGGACCAACATATACCCCGCCATCGGGTCTTATTCGGGACCCTAGTGTCATTTTGCATACCGATGGGAAT
TACTACATCGCCTATACAACCGACTGGACGGGAACAAACTTTGCCATAGCTAGCAGTTCAAACCTAATCAACTGG
ACAAGGCTTGCGACGATATCAACAGCATCTTCGGTCATAACACCAGTAAATACCTGGGCGCCGGAATTTTTCAAG
GATCCTCGGACCGGCAAGCTCAACATCATTGTGTCACTCTCAACTGGAAGTTTTGGCCCATTCCTTCCTTATGTT
TTTACCGCCAGCGATTCGACCTTGAGATCATGGTCTGGTCCAGTCCGAATGTCTGGAATTTCCAACGCTGGGCTC
GGGTATATCGACACTTTCCCGCTGTTCCACAATAATCAATATCATATATTTACCAAGGCGGAGTCTAATGGGAAA
AAGCATATTGAACATGCCGTTGCTACTTCATTAACTGGACCATACTCTTTTGTCCAAACTGGTGACTTCGCGGGA
TGGGGCCAAGCCGAAGGACCATGTGTTACTGTTCTTCCTAATGGAAGATTCCGCCTCTACGCCGATGGATTTAGT
TCTGGCAAATATATCACCGCTGACTCTAGCGACCTTTTCAATTGGACTCCGTTCCAGACGATACCCGGTCTCAGT
GGGGTGGTAAGGCATGGGACGGTTTTGAAGCAATGA
Transcript >AgabiH97|112890
ATGTTCGGTTTCAGATTCGGCACTTTGGCTCTACTTTTTAGTGCAATGTGCACTCAGAGTCTCGCTATGCCTGCT
CTAGGCAACGTGACCTCTACAAGCCCAGAATTATCGATGGAGATGTTTAAACGGGCCGTGTCTGCTCCCTATGTT
TTCACCGCCTTCACTTCTTCATCTGAATCCAACCTCTACGTTTATACCTCGGATGACGGAACGGATTTCAGGTTG
TTAAAAGGACCAACATATACCCCGCCATCGGGTCTTATTCGGGACCCTAGTGTCATTTTGCATACCGATGGGAAT
TACTACATCGCCTATACAACCGACTGGACGGGAACAAACTTTGCCATAGCTAGCAGTTCAAACCTAATCAACTGG
ACAAGGCTTGCGACGATATCAACAGCATCTTCGGTCATAACACCAGTAAATACCTGGGCGCCGGAATTTTTCAAG
GATCCTCGGACCGGCAAGCTCAACATCATTGTGTCACTCTCAACTGGAAGTTTTGGCCCATTCCTTCCTTATGTT
TTTACCGCCAGCGATTCGACCTTGAGATCATGGTCTGGTCCAGTCCGAATGTCTGGAATTTCCAACGCTGGGCTC
GGGTATATCGACACTTTCCCGCTGTTCCACAATAATCAATATCATATATTTACCAAGGCGGAGTCTAATGGGAAA
AAGCATATTGAACATGCCGTTGCTACTTCATTAACTGGACCATACTCTTTTGTCCAAACTGGTGACTTCGCGGGA
TGGGGCCAAGCCGAAGGACCATGTGTTACTGTTCTTCCTAATGGAAGATTCCGCCTCTACGCCGATGGATTTAGT
TCTGGCAAATATATCACCGCTGACTCTAGCGACCTTTTCAATTGGACTCCGTTCCAGACGATACCCGGTCTCAGT
GGGGTGGTAAGGCATGGGACGGTTTTGAAGCAATGA
Gene >AgabiH97|112890
ATGTTCGGTTTCAGATTCGGCACTTTGGCTCTACTTTTTAGTGCAATGTGCACTCAGAGTCTCGCTATGCCTGCT
CTAGGCAACGTGACCTCTACAAGCCCAGAATTATCGATGGAGATGTTTAAACGGGCCGTGTCTGCTCCCTATGTT
TTCACCGCCTTCACTTCTTCATCTGAATCCAACCTCTACGTTTATACCTCGGATGACGGAACGGATTTCAGGTTG
TTAAAAGGACCAACATATACCCCGCCATCGGGTCTTATTCGGGACCCTAGTGTCATTTTGCATACCGAGTATGTG
TACTTATATGCGTATGGCGAGCGATCACATTGATGAAGCATTACAGTGGGAATTACTACATCGCCTGTACGTCTG
TTGCTGTTATCAAATGGTGAAACAGTCGTCAAGGTTTCTTGTTAAGATACAACCGACTGGACGGGAACAAACTTT
GCCATAGCTGTATGTTGATCTGTTTCGACTCGCCAATACTATTCGCGATGGTGTTGATTGATGGTGTTGATACTT
ATGCGGCTTTTGTAGAGCAGTTCAAACCTAATCAACTGGACAAGGCTTGCGACGATATCAACAGCATCTTCGGTC
ATAACACCAGTAAATACCTGGGCGCCGGTAAGTTTATCGTCATGTCCATTCTACTACTGTCCGACTGAAACATTT
TTTTCAGGAATTTTTCAAGGATCCTCGGACCGGCAAGCTCAACATCATTGTGTCACTCTCAACTGGAAGTTTTGG
CCCATTCCTTCCTTATGTTTTTACCGCCAGCGATTCGACCTTGAGATCATGGTCTGGTCCAGTCCGAATGTCTGG
AATTTCCAACGCTGGGCTCGGGTATATCGACACTTTCCCGCTGTTCCACAAGTAAGTCGACAAATTGTCTCATAA
CTCGATTACTTATAGTTGAAATTTATAGTAATCAATATCATATATTTACCAAGGCGGAGTCTAATGGGAAAAAGC
ATATTGAACATGCCGTTGCTACTTCATTAACTGGACCATACTCTTTTGTCCAAACTGGTGACTTCGCGGGATGGG
GCCAAGCCGAAGGACCATGTGTTACTGTTCTTCCTAATGGAAGATTCCGCCTGTAAGTGACATCCATAGTTCGAA
GAGTGTTTTATTTTAAAACTCGACTTCTCAGCTACGCCGATGGATTTAGTTCTGGTGAGCGCTCCTGGGGAAACA
CCTCCTTCCGGTTAGATGAATGCTAACTCGAGAAAATCATTAACAGGCAAATATATCACCGCTGACTCTAGCGAC
CTTTTCAATTGGACTCCGTTCCAGACGATACCCGGTCTCAGTGGGGTGGTAAGGCATGGGACGGTTTTGAAGCAA
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail