Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|112830
Gene name
Locationscaffold_8:1766283..1768316
Strand+
Gene length (bp)2033
Transcript length (bp)1485
Coding sequence length (bp)1485
Protein length (aa) 495

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 4.5E-25 71 204
PF08031 BBE Berberine and berberine like 2.5E-04 452 485

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 23 335 1.0E-38
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 32 308 7.0E-28
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 73 309 8.0E-18
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 62 236 3.0E-12
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 39 256 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 23 335 1.0E-38
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 32 308 7.0E-28
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 73 309 8.0E-18
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 62 236 3.0E-12
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 39 256 5.0E-12
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 54 242 8.0E-12
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 73 240 9.0E-12
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 67 240 1.0E-11
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 134 236 2.0E-11
sp|Q8HXW0|GGLO_PIG L-gulonolactone oxidase OS=Sus scrofa GN=GULO PE=2 SV=3 62 236 4.0E-10
sp|Q3ZC33|GGLO_BOVIN L-gulonolactone oxidase OS=Bos taurus GN=GULO PE=2 SV=3 62 236 1.0E-09
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 64 239 2.0E-09
sp|Q796P5|YITY_BACSU Uncharacterized FAD-linked oxidoreductase YitY OS=Bacillus subtilis (strain 168) GN=yitY PE=3 SV=2 91 232 5.0E-09
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 71 235 2.0E-08
sp|P10867|GGLO_RAT L-gulonolactone oxidase OS=Rattus norvegicus GN=Gulo PE=1 SV=3 62 236 2.0E-08
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 71 240 2.0E-08
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 72 256 8.0E-08
sp|Q4ADV8|CKX2_ORYSJ Cytokinin dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=CKX2 PE=2 SV=1 73 235 2.0E-07
sp|Q2QXY1|GLDH2_ORYSJ L-galactono-1,4-lactone dehydrogenase 2, mitochondrial OS=Oryza sativa subsp. japonica GN=GLDH2 PE=2 SV=1 46 239 5.0E-07
sp|Q90YK3|GGLO_SCYTO L-gulonolactone oxidase OS=Scyliorhinus torazame GN=GULO PE=2 SV=1 61 239 5.0E-07
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 72 267 2.0E-06
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 64 240 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|112830
MVSYGLLTPLVLALLTLPRDTLGYAFKRDSICDTLKDNISSASKVYYPILNELEYLKGIYHWAISSSQHAECVVE
PGTTSDVANILDILGRTRTPFAVKGGGHTSNPGFSSSEGVQIAMYRFSEIDYNEAEQTVTLGAGLIWDDVYAALE
PHGVNVLGGRVTGLGVAGFTLGGGYSWKTNQYGLTIDTVVAFELVKPDGTVLQVTNETDPDLFFGLKGGFNNFGI
VTKFTLKTFPQTQVWGGLITVTESHIDKINEATADFSANVKDPKAEIITAYNFLLGQPGISQILFYDGPNPPSGI
FDKFMDVPFFTRDVKTRSFLDLVQASPSNVTANQRAIFHTVPVLEYTPSFLNVLLNETIFWGRELSNILKLHTGT
FISYAVEPFLPDILAHTDQPSAYPPDRSIRYTPLNVYYVWLAEGNDQLFHDTVKQSVSHLTAAAVNEGQQVQQAP
IYPNYAIYDTPLTKLYGDNLPRLQALKKVHDPDNVMGLAGGFKF*
Coding >AgabiH97|112830
ATGGTGTCCTATGGCCTTTTGACACCTCTCGTATTGGCTCTACTAACCCTTCCGCGCGATACCTTGGGCTATGCT
TTCAAACGGGATTCTATATGTGATACCCTCAAGGATAACATTTCGTCTGCGTCTAAGGTCTATTATCCTATATTG
AATGAGCTCGAATATCTTAAGGGTATATACCACTGGGCAATTTCAAGTTCACAACACGCGGAATGTGTCGTCGAG
CCTGGGACAACTTCAGATGTAGCAAATATCTTGGATATTCTAGGCCGGACCCGAACACCATTTGCGGTTAAAGGC
GGTGGACATACTTCCAATCCAGGGTTTTCTTCATCCGAAGGAGTCCAAATCGCCATGTATCGATTCTCAGAGATT
GATTACAATGAGGCAGAACAAACAGTAACGCTTGGAGCGGGACTTATATGGGACGATGTGTATGCTGCGTTGGAA
CCTCATGGAGTCAATGTTCTCGGTGGACGTGTTACAGGGCTAGGAGTCGCCGGATTTACACTTGGCGGGGGATAT
TCTTGGAAAACCAATCAGTACGGTTTGACAATCGATACAGTCGTCGCATTTGAGCTCGTGAAGCCGGATGGAACA
GTGCTTCAGGTGACTAACGAGACAGATCCTGACCTCTTTTTTGGATTGAAGGGCGGTTTCAACAACTTCGGAATA
GTTACAAAGTTTACGTTAAAGACCTTCCCACAAACTCAGGTCTGGGGCGGCCTGATTACTGTCACAGAATCTCAC
ATAGACAAAATAAACGAAGCTACTGCAGATTTCTCTGCGAACGTGAAAGATCCAAAAGCCGAGATCATCACAGCA
TACAACTTTCTTCTGGGACAGCCCGGCATTTCTCAAATACTCTTTTACGATGGACCAAACCCACCTAGCGGCATC
TTTGATAAATTCATGGACGTTCCATTCTTCACTAGAGATGTGAAGACTCGTAGTTTCCTTGATTTGGTGCAGGCT
TCTCCCTCTAATGTAACCGCCAACCAAAGAGCCATATTCCACACAGTCCCTGTATTGGAATATACACCTTCCTTT
TTGAATGTCCTTCTGAATGAAACTATTTTCTGGGGACGAGAGCTGTCAAACATCTTGAAGCTCCACACTGGGACT
TTTATATCCTACGCCGTCGAACCGTTTTTGCCAGATATCCTCGCTCACACAGATCAGCCTTCTGCTTACCCTCCA
GATCGTTCTATACGATACACTCCCTTGAACGTTTATTACGTCTGGCTCGCAGAAGGGAACGACCAGCTGTTCCAC
GATACTGTCAAGCAGAGTGTTAGCCATTTAACTGCTGCGGCGGTCAATGAAGGCCAACAAGTTCAACAAGCCCCA
ATATATCCAAACTATGCTATCTACGACACTCCTTTGACAAAGCTCTATGGGGACAACCTTCCACGATTGCAAGCA
TTGAAGAAAGTTCATGATCCTGATAACGTTATGGGACTTGCAGGAGGTTTTAAATTTTAG
Transcript >AgabiH97|112830
ATGGTGTCCTATGGCCTTTTGACACCTCTCGTATTGGCTCTACTAACCCTTCCGCGCGATACCTTGGGCTATGCT
TTCAAACGGGATTCTATATGTGATACCCTCAAGGATAACATTTCGTCTGCGTCTAAGGTCTATTATCCTATATTG
AATGAGCTCGAATATCTTAAGGGTATATACCACTGGGCAATTTCAAGTTCACAACACGCGGAATGTGTCGTCGAG
CCTGGGACAACTTCAGATGTAGCAAATATCTTGGATATTCTAGGCCGGACCCGAACACCATTTGCGGTTAAAGGC
GGTGGACATACTTCCAATCCAGGGTTTTCTTCATCCGAAGGAGTCCAAATCGCCATGTATCGATTCTCAGAGATT
GATTACAATGAGGCAGAACAAACAGTAACGCTTGGAGCGGGACTTATATGGGACGATGTGTATGCTGCGTTGGAA
CCTCATGGAGTCAATGTTCTCGGTGGACGTGTTACAGGGCTAGGAGTCGCCGGATTTACACTTGGCGGGGGATAT
TCTTGGAAAACCAATCAGTACGGTTTGACAATCGATACAGTCGTCGCATTTGAGCTCGTGAAGCCGGATGGAACA
GTGCTTCAGGTGACTAACGAGACAGATCCTGACCTCTTTTTTGGATTGAAGGGCGGTTTCAACAACTTCGGAATA
GTTACAAAGTTTACGTTAAAGACCTTCCCACAAACTCAGGTCTGGGGCGGCCTGATTACTGTCACAGAATCTCAC
ATAGACAAAATAAACGAAGCTACTGCAGATTTCTCTGCGAACGTGAAAGATCCAAAAGCCGAGATCATCACAGCA
TACAACTTTCTTCTGGGACAGCCCGGCATTTCTCAAATACTCTTTTACGATGGACCAAACCCACCTAGCGGCATC
TTTGATAAATTCATGGACGTTCCATTCTTCACTAGAGATGTGAAGACTCGTAGTTTCCTTGATTTGGTGCAGGCT
TCTCCCTCTAATGTAACCGCCAACCAAAGAGCCATATTCCACACAGTCCCTGTATTGGAATATACACCTTCCTTT
TTGAATGTCCTTCTGAATGAAACTATTTTCTGGGGACGAGAGCTGTCAAACATCTTGAAGCTCCACACTGGGACT
TTTATATCCTACGCCGTCGAACCGTTTTTGCCAGATATCCTCGCTCACACAGATCAGCCTTCTGCTTACCCTCCA
GATCGTTCTATACGATACACTCCCTTGAACGTTTATTACGTCTGGCTCGCAGAAGGGAACGACCAGCTGTTCCAC
GATACTGTCAAGCAGAGTGTTAGCCATTTAACTGCTGCGGCGGTCAATGAAGGCCAACAAGTTCAACAAGCCCCA
ATATATCCAAACTATGCTATCTACGACACTCCTTTGACAAAGCTCTATGGGGACAACCTTCCACGATTGCAAGCA
TTGAAGAAAGTTCATGATCCTGATAACGTTATGGGACTTGCAGGAGGTTTTAAATTTTAG
Gene >AgabiH97|112830
ATGGTGTCCTATGGCCTTTTGACACCTCTCGTATTGGCTCTACTAACCCTTCCGCGCGATACCTTGGGCTATGCT
TTCAAACGGGATTCTATATGTGATACCCTCAAGGATAACATTTCGTCTGCGTCTAAGGTCTATTATCCTAGTACG
AGTGACTTTCCTGTTTTTGAAAATTTCCGTCACAACTAAATCGTTTTGTCAGTATTGAATGAGCTCGAATATCTT
AAGGGTATATACCACTGGGCAATTTCAAGTTCACAACACGCGGAATGTGTCGTCGAGCCTGGGACAACTTCAGAT
GTAGCAAATATCGTCCGTGGCCGTTTTCTTCCCTTTGCAACGATGTTCCATGCGCTGACAGTTTTGATCATTTGG
TTAGTTGGATATTCTAGGCCGGACCCGAACACCATTTGCGGTGAGTAACGAACTAGCCATTTGTTTCCAGGTCTG
ACCAGAAGCGTTCCCTAAGGTTAAAGGCGGTGGACATACTTCCAATCCAGGGTTTTCTTCATCCGAAGGAGTCCA
AATCGCCATGTATCGATTCTCAGAGATTGATTACAATGAGGCAGAACAAACAGTAACGCTTGGAGCGGGACTTAT
ATGGGACGATGTGTATGCTGCGTTGGAACCTCATGGAGTCAATGTTCTCGGTGGACGTGTTACAGGGCTAGGAGT
CGCCGGATTTACACTTGGCGGGGGTGAGTGAAGCCCATTCCATTCTCCGTCGAGCTCTTTATTCACACGCCGCGC
CGTCAGGATATTCTTGGAAAACCAATCAGTACGGTTTGACAATCGATACAGTCGTCGCATTTGAGCTCGTGAAGC
CGGATGGAACAGTGCTTCAGGTGACTAACGAGACAGATCCTGACCTCTTTTTTGGATTGAAGGTAAGCCACTTAC
AGCAGCATTGGAGCTTGAAATTTTCTCTAAACCTATTAAAATTAGGGCGGTTTCAACAACTTCGTAGGTGTTGTT
GCCATTGTCCTCTCAGCGCAACTGACTTGAAATGTAGGGAATAGTTACAAAGTTTACGTTAAAGACCTTCCCACA
AACTCAGGTCTGGGTGAGTAGAAATACTACTATCAAGTTCACTCAATGCTGAAAGGGTAAAAAGGGCGGCCTGAT
TACTGTCACAGAATCTCACATAGACAAAATAAACGAAGCTACTGCAGATTTCTCTGCGAACGTGAAAGATCCAAA
AGCCGAGATCATCACAGCATACAACTTTCTTCTGGGACAGGTAGGTATCACCGTGCTTGACGGTATACTATCTAT
TCATCTCAAGAAAATTAGCCCGGCATTTCTCAAATACTCTTTTACGATGGACCAAACCCACCTAGCGGCATCTTT
GATAAATTCATGGACGTTCCATTCTTCACTAGAGATGTGAAGACTCGTAGTTTCCTTGATTTGGTGCAGGCTTCT
CCCTCTAATGTAACCGCCAACCAAAGGTAAGGGATAAGGAAAAGAAGCGAACATCATTGCTAATACAGTTTATAG
AGCCATATTCCACACAGTCCCTGTATTGGAATATACACCTTCCTTTTTGAATGTCCTTCTGAATGAAACTATTGT
AAGAATGTTTTTCGAGCTCATATTTCTTTTACTAATGAACACGATCAAAGTTCTGGGGACGAGAGCTGTCAAACA
TCTTGAAGCTCCACACTGGGACTTTTATATCCTACGCCGTCGAACCGTTTTTGCCAGATATCCTCGCTCACACAG
ATCAGCCTTCTGCTTACCCTCCAGATCGTTCTATACGATACACTCCCTTGAACGTTTATTACGTCTGGCTCGCAG
AAGGGAACGACCAGCTGTTCCACGATACTGTCAAGCAGAGTGTTAGCCATTTAACTGCTGCGGCGGTCAATGAAG
GCCAACAAGTTCAACAAGCCCCAATATATCCAAACTATGCTATCTACGACACTCCTTTGACAAAGCTCTATGGGG
ACAACCTTCCACGATTGCAAGCATTGAAGAAAGTTCATGATCCTGATAACGTTATGGGACTTGCAGGAGGTTTTA
AATTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail