Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|112800
Gene name
Locationscaffold_8:1760541..1761326
Strand-
Gene length (bp)785
Transcript length (bp)492
Coding sequence length (bp)492
Protein length (aa) 164

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 6.5E-14 38 132
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 1.2E-08 43 153
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 9.9E-08 43 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTI3|ARD1_SCHPO N-terminal acetyltransferase A complex catalytic subunit ard1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ard1 PE=1 SV=1 1 160 2.0E-60
sp|O61219|DAF31_CAEEL N-alpha-acetyltransferase daf-31 OS=Caenorhabditis elegans GN=daf-31 PE=2 SV=1 1 152 2.0E-58
sp|Q3UX61|NAA11_MOUSE N-alpha-acetyltransferase 11 OS=Mus musculus GN=Naa11 PE=1 SV=1 1 152 5.0E-55
sp|Q4V8K3|NAA11_RAT N-alpha-acetyltransferase 11 OS=Rattus norvegicus GN=Naa11 PE=2 SV=1 1 152 2.0E-54
sp|Q9QY36|NAA10_MOUSE N-alpha-acetyltransferase 10 OS=Mus musculus GN=Naa10 PE=1 SV=1 1 152 4.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTI3|ARD1_SCHPO N-terminal acetyltransferase A complex catalytic subunit ard1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ard1 PE=1 SV=1 1 160 2.0E-60
sp|O61219|DAF31_CAEEL N-alpha-acetyltransferase daf-31 OS=Caenorhabditis elegans GN=daf-31 PE=2 SV=1 1 152 2.0E-58
sp|Q3UX61|NAA11_MOUSE N-alpha-acetyltransferase 11 OS=Mus musculus GN=Naa11 PE=1 SV=1 1 152 5.0E-55
sp|Q4V8K3|NAA11_RAT N-alpha-acetyltransferase 11 OS=Rattus norvegicus GN=Naa11 PE=2 SV=1 1 152 2.0E-54
sp|Q9QY36|NAA10_MOUSE N-alpha-acetyltransferase 10 OS=Mus musculus GN=Naa10 PE=1 SV=1 1 152 4.0E-54
sp|P41227|NAA10_HUMAN N-alpha-acetyltransferase 10 OS=Homo sapiens GN=NAA10 PE=1 SV=1 1 152 4.0E-54
sp|Q2KI14|NAA10_BOVIN N-alpha-acetyltransferase 10 OS=Bos taurus GN=NAA10 PE=2 SV=1 1 152 5.0E-54
sp|Q9BSU3|NAA11_HUMAN N-alpha-acetyltransferase 11 OS=Homo sapiens GN=NAA11 PE=1 SV=3 1 152 1.0E-52
sp|P36416|ARD1_DICDI N-terminal acetyltransferase complex ARD1 subunit homolog OS=Dictyostelium discoideum GN=natA PE=2 SV=1 1 155 4.0E-49
sp|P07347|ARD1_YEAST N-terminal acetyltransferase A complex catalytic subunit ARD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARD1 PE=1 SV=2 1 163 1.0E-42
sp|Q8SSN5|NAA20_DICDI N-alpha-acetyltransferase 20 OS=Dictyostelium discoideum GN=nat5 PE=3 SV=2 2 152 6.0E-25
sp|Q976C3|Y258_SULTO Uncharacterized N-acetyltransferase STK_02580 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_02580 PE=3 SV=1 3 151 6.0E-25
sp|Q4JBG0|Y459_SULAC Uncharacterized N-acetyltransferase Saci_0459 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0459 PE=3 SV=1 3 151 3.0E-22
sp|Q980R9|Y209_SULSO Uncharacterized N-acetyltransferase SSO0209 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0209 PE=1 SV=2 1 151 1.0E-21
sp|Q7ZXR3|NAA20_XENLA N-alpha-acetyltransferase 20 OS=Xenopus laevis GN=naa20 PE=2 SV=1 2 152 5.0E-20
sp|Q6P632|NAA20_XENTR N-alpha-acetyltransferase 20 OS=Xenopus tropicalis GN=naa20 PE=2 SV=1 2 152 6.0E-20
sp|P61599|NAA20_HUMAN N-alpha-acetyltransferase 20 OS=Homo sapiens GN=NAA20 PE=1 SV=1 2 152 6.0E-20
sp|P61600|NAA20_MOUSE N-alpha-acetyltransferase 20 OS=Mus musculus GN=Naa20 PE=1 SV=1 2 152 6.0E-20
sp|Q2PFM2|NAA20_MACFA N-alpha-acetyltransferase 20 OS=Macaca fascicularis GN=NAA20 PE=2 SV=1 2 152 6.0E-20
sp|Q58ED9|NAA20_DANRE N-alpha-acetyltransferase 20 OS=Danio rerio GN=naa20 PE=2 SV=1 2 152 9.0E-20
sp|O74457|NAT3_SCHPO N-terminal acetyltransferase B complex catalytic subunit naa20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=naa20 PE=3 SV=1 2 152 4.0E-15
sp|O80438|MAK3_ARATH N-alpha-acetyltransferase MAK3 OS=Arabidopsis thaliana GN=MAK3 PE=2 SV=1 20 155 1.0E-12
sp|Q05885|ARD1_LEIDO N-terminal acetyltransferase complex ARD1 subunit homolog OS=Leishmania donovani GN=ARD1 PE=3 SV=1 10 153 4.0E-12
sp|O74311|NAA30_SCHPO N-alpha-acetyltransferase 30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=naa30 PE=3 SV=1 20 154 5.0E-12
sp|Q58925|Y1530_METJA Uncharacterized N-acetyltransferase MJ1530 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1530 PE=3 SV=1 23 151 7.0E-11
sp|Q95RC0|NAA30_DROME N-alpha-acetyltransferase 30 OS=Drosophila melanogaster GN=CG11412 PE=2 SV=1 26 155 2.0E-08
sp|Q03503|NAA30_YEAST N-alpha-acetyltransferase 30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK3 PE=1 SV=1 21 153 4.0E-08
sp|P0A947|RIMI_SHIFL Ribosomal-protein-alanine acetyltransferase OS=Shigella flexneri GN=rimI PE=3 SV=1 78 153 2.0E-07
sp|P0A944|RIMI_ECOLI Ribosomal-protein-alanine acetyltransferase OS=Escherichia coli (strain K12) GN=rimI PE=3 SV=1 78 153 2.0E-07
sp|P0A945|RIMI_ECOL6 Ribosomal-protein-alanine acetyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rimI PE=3 SV=1 78 153 2.0E-07
sp|P0A946|RIMI_ECO57 Ribosomal-protein-alanine acetyltransferase OS=Escherichia coli O157:H7 GN=rimI PE=3 SV=1 78 153 2.0E-07
sp|Q54MP9|NAA30_DICDI N-alpha-acetyltransferase 30 OS=Dictyostelium discoideum GN=DDB_G0285803 PE=3 SV=1 20 153 2.0E-07
sp|Q0IHH1|NAA30_XENLA N-alpha-acetyltransferase 30 OS=Xenopus laevis GN=naa30 PE=2 SV=1 20 155 3.0E-06
sp|Q8CES0|NAA30_MOUSE N-alpha-acetyltransferase 30 OS=Mus musculus GN=Naa30 PE=1 SV=2 20 155 3.0E-06
sp|Q147X3|NAA30_HUMAN N-alpha-acetyltransferase 30 OS=Homo sapiens GN=NAA30 PE=1 SV=1 20 155 3.0E-06
sp|Q9NHD5|SAN_DROME Probable N-acetyltransferase san OS=Drosophila melanogaster GN=san PE=1 SV=1 22 148 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0016407 acetyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016410 N-acyltransferase activity No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|112800
MNVRLARAEDLIGMQASNLQNLPENYTMRFWIYHLMSWPQLSYVAEDHKGRIVGYVLSKIDEPDEDNPEGETHGH
VNSISVLREYRRLGIARKMMLLSQDAMEKIYGAAYCSLHVRKSNKAAIALYKETLGFEVAKVEKKYYGDGEDALY
MRLYFDPEENQNS*
Coding >AgabiH97|112800
ATGAACGTCAGACTAGCGAGGGCGGAAGACCTTATCGGCATGCAGGCTAGCAACCTACAGAACTTGCCCGAGAAT
TACACAATGCGTTTTTGGATATACCACCTTATGTCATGGCCTCAGCTGTCCTACGTGGCTGAGGATCATAAAGGC
AGAATAGTCGGATACGTCTTATCAAAAATAGACGAGCCAGACGAGGACAATCCTGAGGGGGAGACACATGGCCAT
GTCAACTCAATCTCCGTCCTAAGGGAATATCGTCGGTTAGGGATCGCCAGAAAAATGATGCTATTATCTCAAGAC
GCTATGGAAAAGATCTATGGAGCAGCCTATTGTTCGCTCCATGTTCGGAAGTCAAATAAAGCAGCCATCGCTTTA
TATAAAGAAACTCTTGGTTTCGAAGTTGCAAAGGTCGAGAAAAAGTATTATGGGGACGGAGAGGATGCGCTTTAC
ATGCGGTTATATTTTGATCCTGAAGAGAATCAAAATTCTTGA
Transcript >AgabiH97|112800
ATGAACGTCAGACTAGCGAGGGCGGAAGACCTTATCGGCATGCAGGCTAGCAACCTACAGAACTTGCCCGAGAAT
TACACAATGCGTTTTTGGATATACCACCTTATGTCATGGCCTCAGCTGTCCTACGTGGCTGAGGATCATAAAGGC
AGAATAGTCGGATACGTCTTATCAAAAATAGACGAGCCAGACGAGGACAATCCTGAGGGGGAGACACATGGCCAT
GTCAACTCAATCTCCGTCCTAAGGGAATATCGTCGGTTAGGGATCGCCAGAAAAATGATGCTATTATCTCAAGAC
GCTATGGAAAAGATCTATGGAGCAGCCTATTGTTCGCTCCATGTTCGGAAGTCAAATAAAGCAGCCATCGCTTTA
TATAAAGAAACTCTTGGTTTCGAAGTTGCAAAGGTCGAGAAAAAGTATTATGGGGACGGAGAGGATGCGCTTTAC
ATGCGGTTATATTTTGATCCTGAAGAGAATCAAAATTCTTGA
Gene >AgabiH97|112800
ATGAACGTCAGACTAGCGAGGGTGCGTCTCGCTGCAGCTTAGCCTTCTAAGATTGATTTAAGTAACAGGCGGAAG
ACCTTATCGGCATGCAGGCTAGCAACCTACAGAACTTGCCCGAGAATTACACAATGCGTTTTTGTCTGTATCTGT
CCCGCTTGGAAACTGCGCAAGCGCCACTGAAAGATTCTCATAATCGCTGAGCAGGGATATACCACCTTATGTCAT
GGCCTCAGCTGTCCTACGTGGCTGAGGATCATAAAGGCAGAATAGTCGGATACGTCTTATCAAAAATGTGAGCGA
GGCTAAACTCTTCCCGGATTATCCTCTCATCGTCTCATTTGCCGTTGGTTGGCAGAGACGAGCCAGACGAGGACA
ATCCTGAGGGGGAGACACATGGCCATGTCAACTCAATCTCCGTCCTAAGGGAATATCGTCGGTTAGGGATCGCCA
GAAAAATGATGCTATTATCTCGTTTGTGTTACCGATTTGGCTTTTTCGATCGTGGAACTCAAAGATACTTTTCTG
CAGAAGACGCTATGGAAAAGATCTATGGAGCAGCCTATTGTTCGCTCCATGTTCGGAAGTCAAATAAAGCAGCCA
TCGCTTTATATAAAGAAACTCTTGGTTTCGAAGTTGCAAAGGTCGAGAAAAAGTATTGTGAGTATATTCAAAAAC
ATATGGCTTAGCAAAATGCTAACTTGTAAACGTATTATATAGATGGGGACGGAGAGGATGCGCTTTACATGCGGT
TATATTTTGATCCTGAAGAGAATCAAAATTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail