Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|112680
Gene name
Locationscaffold_8:1725122..1726373
Strand-
Gene length (bp)1251
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05153 MIOX Myo-inositol oxygenase 2.5E-126 55 301

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Z8T3|MIOX_ORYSJ Probable inositol oxygenase OS=Oryza sativa subsp. japonica GN=Os06g0561000 PE=2 SV=1 20 301 2.0E-93
sp|Q8L799|MIOX1_ARATH Inositol oxygenase 1 OS=Arabidopsis thaliana GN=MIOX1 PE=2 SV=1 42 301 2.0E-90
sp|Q54GH4|MIOX_DICDI Inositol oxygenase OS=Dictyostelium discoideum GN=miox PE=3 SV=1 34 301 5.0E-89
sp|Q4V8T0|MIOX_DANRE Inositol oxygenase OS=Danio rerio GN=miox PE=2 SV=1 43 301 2.0E-88
sp|O82200|MIOX2_ARATH Inositol oxygenase 2 OS=Arabidopsis thaliana GN=MIOX2 PE=2 SV=2 40 301 7.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Z8T3|MIOX_ORYSJ Probable inositol oxygenase OS=Oryza sativa subsp. japonica GN=Os06g0561000 PE=2 SV=1 20 301 2.0E-93
sp|Q8L799|MIOX1_ARATH Inositol oxygenase 1 OS=Arabidopsis thaliana GN=MIOX1 PE=2 SV=1 42 301 2.0E-90
sp|Q54GH4|MIOX_DICDI Inositol oxygenase OS=Dictyostelium discoideum GN=miox PE=3 SV=1 34 301 5.0E-89
sp|Q4V8T0|MIOX_DANRE Inositol oxygenase OS=Danio rerio GN=miox PE=2 SV=1 43 301 2.0E-88
sp|O82200|MIOX2_ARATH Inositol oxygenase 2 OS=Arabidopsis thaliana GN=MIOX2 PE=2 SV=2 40 301 7.0E-88
sp|Q8H1S0|MIOX4_ARATH Inositol oxygenase 4 OS=Arabidopsis thaliana GN=MIOX4 PE=2 SV=1 42 301 3.0E-87
sp|Q9FJU4|MIOX5_ARATH Inositol oxygenase 5 OS=Arabidopsis thaliana GN=MIOX5 PE=2 SV=1 42 301 8.0E-85
sp|Q5REY9|MIOX_PONAB Inositol oxygenase OS=Pongo abelii GN=MIOX PE=2 SV=1 43 301 3.0E-84
sp|Q9UGB7|MIOX_HUMAN Inositol oxygenase OS=Homo sapiens GN=MIOX PE=1 SV=1 43 301 5.0E-83
sp|Q9QXN4|MIOX_RAT Inositol oxygenase OS=Rattus norvegicus GN=Miox PE=1 SV=2 43 301 1.0E-82
sp|A7MBE4|MIOX_BOVIN Inositol oxygenase OS=Bos taurus GN=MIOX PE=2 SV=1 35 301 1.0E-82
sp|Q8WN98|MIOX_PIG Inositol oxygenase OS=Sus scrofa GN=MIOX PE=1 SV=1 43 301 1.0E-81
sp|Q9QXN5|MIOX_MOUSE Inositol oxygenase OS=Mus musculus GN=Miox PE=1 SV=2 43 301 5.0E-81
[Show less]

GO

GO Term Description Terminal node
GO:0019310 inositol catabolic process Yes
GO:0050113 inositol oxygenase activity Yes
GO:0005506 iron ion binding Yes
GO:0005737 cytoplasm Yes
GO:0071704 organic substance metabolic process No
GO:1901616 organic hydroxy compound catabolic process No
GO:0006020 inositol metabolic process No
GO:0008152 metabolic process No
GO:0046174 polyol catabolic process No
GO:0044281 small molecule metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0006066 alcohol metabolic process No
GO:0043169 cation binding No
GO:0044248 cellular catabolic process No
GO:0046872 metal ion binding No
GO:0005575 cellular_component No
GO:0046164 alcohol catabolic process No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0110165 cellular anatomical entity No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:1901615 organic hydroxy compound metabolic process No
GO:0004497 monooxygenase activity No
GO:0019751 polyol metabolic process No
GO:0016491 oxidoreductase activity No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No
GO:0016052 carbohydrate catabolic process No
GO:0003674 molecular_function No
GO:0005975 carbohydrate metabolic process No
GO:0044275 cellular carbohydrate catabolic process No
GO:0044282 small molecule catabolic process No
GO:1901575 organic substance catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|112680
MSVVTEELSYRGRELESISDAIDDVNVLKGKTWSKKSELDENKSKKSFRNYENACDRVKDFYRLQHRKQTVEFNL
KARAAFRNRKRVSMSVWQAIELLNTLVDESDPDTSMSQIEHLLQTAEAIRRDGKPEWMQVTGLLHDLGKLLLLFG
SEGQWDVVGDTFVVGCQFSEKCIYPETFRSNPDSRHPVYSTKFGIYEPNCGLDNVMLCWGHDEYLYQVLKDQCTL
PPEGLAMIRYHSFYPWHREGAYEHLCNENDKKLLAAVQAFNPYDLYSKSDERVNPEKLRPYYEGLIAKFFPPILE
W*
Coding >AgabiH97|112680
ATGAGCGTCGTTACTGAAGAGCTCAGCTACCGTGGTCGTGAACTTGAAAGTATATCCGACGCTATTGACGATGTC
AACGTTCTGAAGGGGAAAACATGGAGCAAAAAATCCGAACTTGACGAGAACAAAAGCAAAAAAAGTTTTCGTAAC
TACGAAAATGCTTGTGACCGCGTGAAGGATTTCTACCGTTTGCAGCACAGGAAGCAAACCGTCGAGTTTAACTTG
AAAGCTCGTGCCGCATTTCGGAACCGCAAGCGTGTTAGCATGAGCGTTTGGCAAGCCATCGAGCTATTGAACACG
TTGGTTGACGAGTCAGACCCAGACACAAGTATGTCACAAATAGAACATCTACTTCAAACTGCAGAAGCCATTCGA
CGTGATGGTAAACCAGAGTGGATGCAGGTAACCGGACTTCTCCATGATTTGGGAAAACTTCTTTTGTTATTCGGT
TCCGAAGGGCAGTGGGATGTTGTAGGAGACACTTTTGTCGTTGGATGCCAGTTTTCCGAAAAATGCATCTATCCC
GAGACCTTCAGGAGTAACCCCGACTCAAGGCACCCCGTTTACTCGACCAAGTTTGGTATCTATGAACCAAACTGT
GGGCTGGACAACGTCATGCTTTGTTGGGGTCACGATGAGTATCTCTATCAGGTCCTTAAGGACCAGTGTACCCTT
CCCCCAGAAGGACTTGCCATGATCAGGTATCACAGTTTTTACCCTTGGCACCGCGAAGGCGCATATGAACACCTC
TGCAACGAAAACGATAAAAAGCTCTTGGCAGCTGTGCAAGCCTTCAATCCTTACGACCTCTACAGCAAAAGTGAC
GAACGTGTAAATCCTGAAAAGCTTCGTCCGTACTATGAGGGTCTTATTGCGAAATTTTTCCCTCCTATTCTGGAG
TGGTAG
Transcript >AgabiH97|112680
ATGAGCGTCGTTACTGAAGAGCTCAGCTACCGTGGTCGTGAACTTGAAAGTATATCCGACGCTATTGACGATGTC
AACGTTCTGAAGGGGAAAACATGGAGCAAAAAATCCGAACTTGACGAGAACAAAAGCAAAAAAAGTTTTCGTAAC
TACGAAAATGCTTGTGACCGCGTGAAGGATTTCTACCGTTTGCAGCACAGGAAGCAAACCGTCGAGTTTAACTTG
AAAGCTCGTGCCGCATTTCGGAACCGCAAGCGTGTTAGCATGAGCGTTTGGCAAGCCATCGAGCTATTGAACACG
TTGGTTGACGAGTCAGACCCAGACACAAGTATGTCACAAATAGAACATCTACTTCAAACTGCAGAAGCCATTCGA
CGTGATGGTAAACCAGAGTGGATGCAGGTAACCGGACTTCTCCATGATTTGGGAAAACTTCTTTTGTTATTCGGT
TCCGAAGGGCAGTGGGATGTTGTAGGAGACACTTTTGTCGTTGGATGCCAGTTTTCCGAAAAATGCATCTATCCC
GAGACCTTCAGGAGTAACCCCGACTCAAGGCACCCCGTTTACTCGACCAAGTTTGGTATCTATGAACCAAACTGT
GGGCTGGACAACGTCATGCTTTGTTGGGGTCACGATGAGTATCTCTATCAGGTCCTTAAGGACCAGTGTACCCTT
CCCCCAGAAGGACTTGCCATGATCAGGTATCACAGTTTTTACCCTTGGCACCGCGAAGGCGCATATGAACACCTC
TGCAACGAAAACGATAAAAAGCTCTTGGCAGCTGTGCAAGCCTTCAATCCTTACGACCTCTACAGCAAAAGTGAC
GAACGTGTAAATCCTGAAAAGCTTCGTCCGTACTATGAGGGTCTTATTGCGAAATTTTTCCCTCCTATTCTGGAG
TGGTAG
Gene >AgabiH97|112680
ATGAGCGTCGTTACTGAAGAGCTCAGCTACCGTGGTCGTGAACTTGAAAGTATATCCGACGCTATTGACGATGGT
ATCTTCGCTTACTCGCTCAAATGTGAATAAACACCAATTCGCTGACACTCATCTGTAGTCAACGTTCTGAAGGGG
AAAACATGGAGCAAAAAATCCGAACTTGACGAGAACAAAAGCAAAAAAAGTTTTCGTAACTACGAAAATGCTTGT
GACCGCGTGAAGGATTTCTACCGTTTGCAGCACAGTATGCAATTCCTATTCCTATTTACCACACAGTGATTTTGA
TTATTCATGTACACAGGGAAGCAAACCGTCGAGTTTAACTTGAAAGCTCGTGCCGCATTTCGGAACCGCAAGCGT
GTTAGCATGAGCGTTTGGCAAGCCATCGAGCTATTGAACACGTTGGTTGACGAGTCAGACCCAGACGTCGGTGGT
TTTCATTTCTTCTCGAAATTTTTGTTGCTGACGTGTCAACTCTGCAGACAAGTATGTCACAAATAGAACATCTAC
TTCAAACTGCAGAAGCCATTCGACGTGATGGTAAACCAGAGTGGATGCAGGTTTGTCTCGGTGTTTTGCGATCCC
CTGAATCTGGCATGTGCTTATCTCGACACCGTGATCCGCAGGTAACCGGACTTCTCCATGATTTGGGAAAACTTC
TTTTGTTATTCGGTTCCGAAGGGCAGTGGGATGTTGTAGGAGTTAGTTTGGTCAATGTTTCAGTCTCCCTCAGAA
CGCTAATATCACTCTCAGGACACTTTTGTCGTTGGATGCCAGTTTTCCGAAAAATGCATCTATCCCGAGACCTTC
AGGAGTAACCCCGACTCAAGGCACCCCGTTTACTCGACCAAGTTTGGTATCTATGAACCAAACTGTGGGCTGGAC
AACGTCATGCTTTGTTGGGGTCACGATGAGGTAAATTAAATGCCGACTATTCCCATCATATAAATATTCTAAGCC
CCATTCCAGTATCTCTATCAGGTCCTTAAGGACCAGTGTACCCTTCCCCCAGAAGGACTTGCCATGATCAGGTAT
CACAGTTTTTACCCTTGGCACCGCGAAGGCGCATATGAACACCTCTGCAACGAAAACGATAAAAAGCTCTTGGCA
GCTGTGCAAGCCTTCAATCCTTACGACCTCTACAGCAAAAGTGACGAACGTGTAAATCCTGAAAAGCTTCGTCCG
TACTATGAGGGTCTTATTGCGAAATTTTTCCCTCCTATTCTGGAGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail