Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|112640
Gene name
Locationscaffold_8:1713177..1716345
Strand-
Gene length (bp)3168
Transcript length (bp)2505
Coding sequence length (bp)2505
Protein length (aa) 835

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10367 Vps39_2 Vacuolar sorting protein 39 domain 2 1.1E-08 643 706
PF10366 Vps39_1 Vacuolar sorting protein 39 domain 1 7.4E-06 198 295

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8WUH2|TGFA1_HUMAN Transforming growth factor-beta receptor-associated protein 1 OS=Homo sapiens GN=TGFBRAP1 PE=1 SV=1 9 379 2.0E-11
sp|A7MB11|TGFA1_BOVIN Transforming growth factor-beta receptor-associated protein 1 OS=Bos taurus GN=TGFBRAP1 PE=2 SV=1 9 380 5.0E-10
sp|Q3UR70|TGFA1_MOUSE Transforming growth factor-beta receptor-associated protein 1 OS=Mus musculus GN=Tgfbrap1 PE=1 SV=1 9 380 2.0E-09
sp|A4IG72|TGFA1_DANRE Transforming growth factor-beta receptor-associated protein 1 homolog OS=Danio rerio GN=tgfbrap1 PE=2 SV=1 9 343 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|112640
MHAFPRSSLLVLQNNAVSALIPTSLIDEVDVLLDSNHINDAALLVDQRRRQLESNLTVDPDEAEELEYVYQTIGF
KCFSQTLFEDAGRNLFNGALDPRILISYYPDLYGSLFSSTGQIDVYSGVAERMPSDKNVDELIRNYSPHLEPDIQ
DAPAAVELRQVLGNAARDMLLVFLEKSRRRARVERRKEDVRSDVVRVVDTVLAKLYALHDRIQELRALLTDSNDV
VLSEIEPSLRKLGFFSLLADLYQKQGQEDKLLDLYSACAEGAYSNTDIEDPLQNIVTLLESKKDKDRKQQVKWGL
WILQRGDLEHGMKLLIPPDTPKRRERDRDREDDLSLLEQITSANQAAGKRFLEYLVVTKRSTSSELHTRLALSCV
DELLQCLEDETTLKLWRAKASSYASPRPPSSPLLSSPSQSQPQSQPPSFHLQQLPSPPLLARHQTSQPQPFLAYF
ASTTPNSPSKRTRLKTIMMLSGSGLYDANVVKDRIRSARERDLVENYESGKGKGKTIDVLALESAILDGKLGHHA
LALSTLVHDLRDSVSAETYCTLGGEVVPAKLALATAESTAPSASSSVELALKEWYLGLFEPLQVPKSKRGGVGAM
GGMESAMVRQRSVKDEVKTALLTDLIGVYSRDGALGVERTKRLLDSQGVNLDVVDIVTLVPDDWPLSSLNTFLAR
HFRRTLHKMHENTIQKNLSAGQNLAVRERSYPILRDAGYLIEEPDSEDELGGVVDEKAAYVQVEEVVEKMINRDD
VVNEKTPSPDYQPQRHVLQEQQSAEEVEESVGAVHSDSRDEAPGQGRVEERSMLGLILDEGVSGERDGDSVETGD
EEEEGRSIR*
Coding >AgabiH97|112640
ATGCATGCGTTTCCGCGGTCATCCCTGCTCGTCCTCCAGAACAATGCTGTCTCTGCGCTCATCCCCACTTCCCTC
ATCGACGAGGTAGACGTCCTCCTCGACAGCAACCACATCAATGATGCCGCGCTCCTCGTCGACCAGCGCCGACGA
CAACTCGAAAGCAATTTAACCGTGGACCCGGATGAGGCGGAGGAACTCGAATATGTCTACCAGACCATTGGCTTC
AAGTGTTTCTCCCAGACCCTCTTTGAAGATGCGGGCAGGAACTTATTTAACGGCGCTCTAGACCCTCGCATACTC
ATCAGCTATTACCCGGATTTATATGGCTCCCTGTTCTCGTCTACTGGCCAGATAGATGTTTACTCTGGTGTCGCC
GAACGTATGCCTTCCGATAAAAATGTAGACGAGTTAATCAGGAACTACTCTCCGCACTTGGAACCCGATATACAG
GATGCGCCAGCAGCTGTAGAACTCAGACAAGTATTAGGAAATGCTGCGAGAGATATGCTGTTGGTGTTCTTGGAG
AAATCGAGGAGGCGCGCGAGAGTGGAAAGGAGGAAAGAAGACGTGAGGAGTGATGTTGTTCGTGTTGTAGATACC
GTTTTGGCAAAACTTTATGCTCTTCACGACAGGATCCAAGAGCTCCGAGCGCTTCTGACCGACTCAAACGACGTT
GTCTTATCGGAAATCGAGCCTTCTTTGCGAAAGCTCGGATTTTTTTCCCTGTTAGCCGACCTATACCAGAAACAA
GGGCAAGAAGACAAACTGCTCGACCTATATTCCGCGTGCGCCGAAGGCGCATACTCAAACACTGACATCGAAGAC
CCACTACAAAATATTGTAACCCTTTTAGAGTCGAAAAAGGACAAAGACCGCAAACAACAAGTCAAATGGGGCCTT
TGGATACTCCAAAGAGGTGATTTAGAACATGGAATGAAGCTTCTTATTCCACCAGATACGCCCAAACGACGAGAG
AGAGATCGTGATAGGGAAGATGATCTTTCATTACTCGAGCAGATTACTAGTGCGAACCAGGCCGCTGGTAAGCGC
TTCCTTGAGTATCTTGTCGTGACAAAGCGAAGCACGTCTTCAGAACTGCATACACGATTAGCACTCTCATGCGTT
GATGAGCTTCTACAATGTCTTGAGGATGAAACAACGTTGAAACTCTGGCGTGCCAAAGCCTCGTCATACGCTTCA
CCTCGACCACCTTCATCTCCTCTCTTATCTTCACCCAGCCAATCTCAACCTCAATCTCAGCCGCCCTCTTTTCAT
CTACAACAACTCCCATCTCCCCCTCTCCTCGCCCGCCACCAAACATCTCAACCACAACCTTTCCTAGCATATTTT
GCTTCAACAACGCCAAACTCGCCATCCAAACGTACACGGCTAAAAACTATAATGATGCTTTCTGGAAGCGGGTTG
TATGATGCGAATGTTGTCAAAGACCGAATACGCTCTGCGCGTGAGCGTGATTTGGTTGAAAATTATGAGAGTGGG
AAAGGCAAGGGGAAGACGATTGATGTTTTGGCACTTGAATCTGCTATTTTGGACGGGAAGCTAGGGCATCATGCA
TTGGCGTTATCAACACTGGTTCACGACCTCAGAGATTCAGTATCTGCAGAAACATACTGTACACTCGGTGGTGAA
GTCGTGCCGGCAAAACTTGCTTTAGCTACTGCTGAAAGCACAGCTCCATCAGCATCATCATCGGTAGAGTTGGCA
TTGAAAGAATGGTATCTGGGGTTGTTTGAACCACTTCAAGTTCCGAAATCTAAACGTGGTGGTGTTGGTGCGATG
GGTGGAATGGAATCTGCTATGGTTAGGCAGAGAAGTGTGAAAGATGAGGTGAAGACGGCTTTGTTGACTGATTTG
ATAGGTGTTTATTCGCGTGATGGAGCGCTTGGTGTGGAACGTACAAAGCGATTATTGGATTCTCAGGGTGTTAAT
CTAGATGTCGTCGACATCGTGACGTTAGTACCAGATGACTGGCCCCTCTCGTCACTCAACACATTCCTCGCAAGA
CATTTCCGAAGAACGTTACACAAAATGCATGAGAATACAATCCAAAAAAACTTGAGCGCCGGACAAAATTTGGCT
GTTCGAGAACGTTCATATCCAATATTACGAGATGCCGGATATCTCATTGAAGAACCTGATTCTGAAGATGAGTTG
GGTGGAGTGGTGGATGAGAAAGCGGCGTATGTGCAAGTTGAGGAAGTGGTGGAGAAAATGATCAATCGGGATGAT
GTTGTTAATGAGAAAACACCGTCTCCGGATTATCAACCTCAGCGGCATGTGTTACAGGAACAACAGAGTGCGGAG
GAAGTGGAGGAATCTGTGGGTGCGGTGCATAGTGATAGTCGCGATGAGGCGCCAGGGCAAGGACGGGTGGAGGAG
AGGAGTATGTTGGGGTTGATTTTGGATGAGGGCGTGAGTGGGGAGAGGGATGGAGATAGCGTGGAAACTGGAGAC
GAAGAAGAGGAAGGGAGGAGTATCCGATAG
Transcript >AgabiH97|112640
ATGCATGCGTTTCCGCGGTCATCCCTGCTCGTCCTCCAGAACAATGCTGTCTCTGCGCTCATCCCCACTTCCCTC
ATCGACGAGGTAGACGTCCTCCTCGACAGCAACCACATCAATGATGCCGCGCTCCTCGTCGACCAGCGCCGACGA
CAACTCGAAAGCAATTTAACCGTGGACCCGGATGAGGCGGAGGAACTCGAATATGTCTACCAGACCATTGGCTTC
AAGTGTTTCTCCCAGACCCTCTTTGAAGATGCGGGCAGGAACTTATTTAACGGCGCTCTAGACCCTCGCATACTC
ATCAGCTATTACCCGGATTTATATGGCTCCCTGTTCTCGTCTACTGGCCAGATAGATGTTTACTCTGGTGTCGCC
GAACGTATGCCTTCCGATAAAAATGTAGACGAGTTAATCAGGAACTACTCTCCGCACTTGGAACCCGATATACAG
GATGCGCCAGCAGCTGTAGAACTCAGACAAGTATTAGGAAATGCTGCGAGAGATATGCTGTTGGTGTTCTTGGAG
AAATCGAGGAGGCGCGCGAGAGTGGAAAGGAGGAAAGAAGACGTGAGGAGTGATGTTGTTCGTGTTGTAGATACC
GTTTTGGCAAAACTTTATGCTCTTCACGACAGGATCCAAGAGCTCCGAGCGCTTCTGACCGACTCAAACGACGTT
GTCTTATCGGAAATCGAGCCTTCTTTGCGAAAGCTCGGATTTTTTTCCCTGTTAGCCGACCTATACCAGAAACAA
GGGCAAGAAGACAAACTGCTCGACCTATATTCCGCGTGCGCCGAAGGCGCATACTCAAACACTGACATCGAAGAC
CCACTACAAAATATTGTAACCCTTTTAGAGTCGAAAAAGGACAAAGACCGCAAACAACAAGTCAAATGGGGCCTT
TGGATACTCCAAAGAGGTGATTTAGAACATGGAATGAAGCTTCTTATTCCACCAGATACGCCCAAACGACGAGAG
AGAGATCGTGATAGGGAAGATGATCTTTCATTACTCGAGCAGATTACTAGTGCGAACCAGGCCGCTGGTAAGCGC
TTCCTTGAGTATCTTGTCGTGACAAAGCGAAGCACGTCTTCAGAACTGCATACACGATTAGCACTCTCATGCGTT
GATGAGCTTCTACAATGTCTTGAGGATGAAACAACGTTGAAACTCTGGCGTGCCAAAGCCTCGTCATACGCTTCA
CCTCGACCACCTTCATCTCCTCTCTTATCTTCACCCAGCCAATCTCAACCTCAATCTCAGCCGCCCTCTTTTCAT
CTACAACAACTCCCATCTCCCCCTCTCCTCGCCCGCCACCAAACATCTCAACCACAACCTTTCCTAGCATATTTT
GCTTCAACAACGCCAAACTCGCCATCCAAACGTACACGGCTAAAAACTATAATGATGCTTTCTGGAAGCGGGTTG
TATGATGCGAATGTTGTCAAAGACCGAATACGCTCTGCGCGTGAGCGTGATTTGGTTGAAAATTATGAGAGTGGG
AAAGGCAAGGGGAAGACGATTGATGTTTTGGCACTTGAATCTGCTATTTTGGACGGGAAGCTAGGGCATCATGCA
TTGGCGTTATCAACACTGGTTCACGACCTCAGAGATTCAGTATCTGCAGAAACATACTGTACACTCGGTGGTGAA
GTCGTGCCGGCAAAACTTGCTTTAGCTACTGCTGAAAGCACAGCTCCATCAGCATCATCATCGGTAGAGTTGGCA
TTGAAAGAATGGTATCTGGGGTTGTTTGAACCACTTCAAGTTCCGAAATCTAAACGTGGTGGTGTTGGTGCGATG
GGTGGAATGGAATCTGCTATGGTTAGGCAGAGAAGTGTGAAAGATGAGGTGAAGACGGCTTTGTTGACTGATTTG
ATAGGTGTTTATTCGCGTGATGGAGCGCTTGGTGTGGAACGTACAAAGCGATTATTGGATTCTCAGGGTGTTAAT
CTAGATGTCGTCGACATCGTGACGTTAGTACCAGATGACTGGCCCCTCTCGTCACTCAACACATTCCTCGCAAGA
CATTTCCGAAGAACGTTACACAAAATGCATGAGAATACAATCCAAAAAAACTTGAGCGCCGGACAAAATTTGGCT
GTTCGAGAACGTTCATATCCAATATTACGAGATGCCGGATATCTCATTGAAGAACCTGATTCTGAAGATGAGTTG
GGTGGAGTGGTGGATGAGAAAGCGGCGTATGTGCAAGTTGAGGAAGTGGTGGAGAAAATGATCAATCGGGATGAT
GTTGTTAATGAGAAAACACCGTCTCCGGATTATCAACCTCAGCGGCATGTGTTACAGGAACAACAGAGTGCGGAG
GAAGTGGAGGAATCTGTGGGTGCGGTGCATAGTGATAGTCGCGATGAGGCGCCAGGGCAAGGACGGGTGGAGGAG
AGGAGTATGTTGGGGTTGATTTTGGATGAGGGCGTGAGTGGGGAGAGGGATGGAGATAGCGTGGAAACTGGAGAC
GAAGAAGAGGAAGGGAGGAGTATCCGATAG
Gene >AgabiH97|112640
ATGCATGCGTTTCCGCGGTCATCCCTGCTCGTCCTCCAGAACAATGCTGTCTCTGCGCTCATCCCCACTTCCCTC
ATCGACGAGGTAGACGTCCTCCTCGACAGCAACCACATCAATGATGCCGCGCTCCTCGTCGACCAGCGCCGACGA
CAACTCGAAAGCAATTTAACCGTGGACCCGGATGAGGTATGCGCGTTATGTGCATCCGCAGTCGGCTATATATAA
TATATAATGTTTCTGGCTTGTAGGCGGAGGAACTCGAATATGTCTACCAGACCATTGGCTTCAAGTGTTTCTCCC
AGACCCTCTTTGAAGATGCGGGCAGGAACTTATTTAACGGCGCTCTAGACCCTCGCATACTCATCAGCTATTACC
CGGATTTATATGGCTCCCTGTTCTCGTCTACTGGCCAGATAGATGTTTACTCTGGTGTCGCCGAACGTATGCCTT
CCGATAAAAATGTAGACGAGTTAAGTAAGTGCCCCTTCCTTGACACGTCCCCATCCCCACTCCCACCCTATATTT
CTCCAACGTTCCCTCCGGCCTCGCGACAAATCAACACTCATCGACTTTATTCTTTTTTACCGCATAATTTGTTCC
ACACAATCTGGAACTGACAGTCGCAATGAACCTAGTCAGGAACTACTCTCCGCACTTGGAACCCGATATACAGGA
TGCGCCAGCAGCTGTAGAACTCAGACAAGTATTAGGAAATGCTGCGAGAGATATGCTGTTGGTGTTCTTGGAGAA
ATCGAGGAGGCGCGCGAGAGTGGAAAGGAGGAAAGAAGACGTGAGGAGTGATGTTGTTCGTGTAAGCATCTTCCT
TTCAGTATTTACTTCTCGAAGACGTCCTGATCGTGTCATCAAGGTTGTAGATACCGTTTTGGCAAAACTTTATGC
TCTTCACGACAGGATCCAAGAGCTCCGAGCGCTTCTGACCGACTCAAACGACGTTGTCTTATCGGAAATCGAGCC
TTCTTTGCGAAAGCTCGGATTTTTTTCCCTGTTAGCCGACCTATACCAGAAACAAGGGCAAGAAGACAAACTGCT
CGACCTATATTCCGCGTGCGCCGAAGGCGCATACTCAAACACTGACATCGAAGACCCACTACAAAATATTGTAAC
CCTTTTAGAGTCGAAAAAGGACAAAGACCGCAAACAACAAGTCAAATGGGGCCTTTGGATACTCCAAAGAGGTGA
TTTAGAACATGGAATGAAGGTGTGTAGTTCCTTGGTACTTTGGAATACAATCTGAAAAGATGCAGCTTCTTATTC
CACCAGATACGCCCAAACGACGAGAGAGAGATCGTGATAGGGAAGATGATCTTTCATTACTCGAGCAGATTACTA
GTGCGAACCAGGCCGCTGGTAAGCGCTTCCTTGAGTATCTTGTCGTGACAAAGCGAAGCACGGTATGTCTTCATG
ATATTTCCCTTGGAATTAAACTCAAATACACATATAGTCTTCAGAACTGCATACACGATTAGCACTCTCATGCGT
TGATGAGCTTCTACAATGTCTTGAGGATGAAACAACGTTGAAACTCTGGCGTGCCAAAGGTACGTATGAAAAGTT
ATGTCCGCTCATCGATTTCTCAAAATAGGGCATAGCCTCGTCATACGCTTCACCTCGACCACCTTCATCTCCTCT
CTTATCTTCACCCAGCCAATCTCAACCTCAATCTCAGCCGCCCTCTTTTCATCTACAACAACTCCCATCTCCCCC
TCTCCTCGCCCGCCACCAAACATCTCAACCACAACCTTTCCTAGCATATTTTGCTTCAACAACGCCAAACTCGCC
ATCCAAACGTACACGGCTAAAAACTATAATGATGCTTTCTGGAAGCGGGTTGTATGATGCGAATGTTGTCAAAGA
CCGAATACGCTCTGCGCGTGAGCGTGATTTGGTTGAAAATTATGAGAGTGGGAAAGGCAAGGGGAAGACGATTGA
TGTTTTGGCACTTGAATCTGCTATTTTGGACGGGAAGGTACCTTTTTTCCTGAAGACTCAATGTCAATGGTTTTT
ATCTGACACTTTCTTTCTAGCTAGGGCATCATGCATTGGCGTTATCAACACTGGTTCACGACCTCAGAGATTCAG
TATCTGCAGAAACATACTGTACACTCGGTGGTGAAGTCGTGCCGGCAAAACTTGCTTTAGCTACTGCTGAAAGCA
CAGCTCCATCAGCATCATCATCGGTAGAGTTGGCATTGAAAGAATGGTATCTGGGGTTGTTTGAACCACTTCAAG
TTCCGAAATCTAAACGTGGTGGTGTTGGTGCGATGGGTGGAATGGAATCTGCTATGGTTAGGCAGAGAAGTGTGA
AAGATGAGGTGAAGACGGCTTTGTTGACTGATTTGATAGGTGTTTATTCGCGTGATGGGTACGTTCTTTTGCGCT
TTATGCCCTATTTCTTCTAACAGTTATGATAGAGCGCTTGGTGTGGAACGTACAAAGCGATTATTGGATTCTCAG
GGTGTTAATCTAGATGTCGTCGACGTGAGTTTTCTCTTTTCATCCCAACCTAACAGGTCTGATATATATATGCGC
GTGTAGATCGTGACGTTAGTACCAGATGACTGGCCCCTCTCGTCACTCAACACATTCCTCGCAAGACATTTCCGA
AGAACGTTACACAAAATGCATGAGAATACAATCCAAAAAAACTTGAGCGCCGGACAAAATTTGGCTGTACGTCCT
TAATCTCTCTATAATAAACAACCCGTTTACTGACAGATATCCTTCTTTTATTTCTTTTGACAGGTTCGAGAACGT
TCATATCCAATATTACGAGATGCCGGATATCTCATTGAAGAACCTGATTCTGAAGATGAGTTGGGTGGAGTGGTG
GATGAGAAAGCGGCGTATGTGCAAGTTGAGGAAGTGGTGGAGAAAATGATCAATCGGGATGATGTTGTTAATGAG
AAAACACCGTCTCCGGATTATCAACCTCAGCGGCATGTGTTACAGGAACAACAGAGTGCGGAGGAAGTGGAGGAA
TCTGTGGGTGCGGTGCATAGTGATAGTCGCGATGAGGCGCCAGGGCAAGGACGGGTGGAGGAGAGGAGTATGTTG
GGGTTGATTTTGGATGAGGGCGTGAGTGGGGAGAGGGATGGAGATAGCGTGGAAACTGGAGACGAAGAAGAGGAA
GGGAGGAGTATCCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail