Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|112580
Gene name
Locationscaffold_8:1690709..1692183
Strand-
Gene length (bp)1474
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19086 Terpene_syn_C_2 Terpene synthase family 2, C-terminal metal binding 3.7E-53 84 280
PF03936 Terpene_synth_C Terpene synthase family, metal binding domain 2.2E-08 155 278

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8NE23|COP3_COPC7 Alpha-muurolene synthase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP3 PE=1 SV=1 8 341 0.0E+00
sp|A8NU13|COP4_COPC7 Linoleate 10R-lipoxygenase COP4 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP4 PE=1 SV=1 6 343 7.0E-47
sp|P0DL13|PRO1_ARMGA Delta(6)-protoilludene synthase OS=Armillaria gallica GN=PRO1 PE=1 SV=1 14 342 3.0E-46
sp|Q6WP50|BOT2_BOTFU Presilphiperfolan-8-beta-ol synthase OS=Botryotinia fuckeliana GN=BOT2 PE=1 SV=1 74 343 2.0E-27
sp|B2J4A4|GERAS_NOSP7 Germacrene A synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_R3832 PE=1 SV=1 66 324 7.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8NE23|COP3_COPC7 Alpha-muurolene synthase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP3 PE=1 SV=1 8 341 0.0E+00
sp|A8NU13|COP4_COPC7 Linoleate 10R-lipoxygenase COP4 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP4 PE=1 SV=1 6 343 7.0E-47
sp|P0DL13|PRO1_ARMGA Delta(6)-protoilludene synthase OS=Armillaria gallica GN=PRO1 PE=1 SV=1 14 342 3.0E-46
sp|Q6WP50|BOT2_BOTFU Presilphiperfolan-8-beta-ol synthase OS=Botryotinia fuckeliana GN=BOT2 PE=1 SV=1 74 343 2.0E-27
sp|B2J4A4|GERAS_NOSP7 Germacrene A synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_R3832 PE=1 SV=1 66 324 7.0E-26
sp|D8RLD3|MTS17_SELML (+)-germacrene D synthase OS=Selaginella moellendorffii GN=SELMODRAFT_412756 PE=1 SV=1 43 326 1.0E-18
sp|J9R1J8|MTS1_SELML Microbial Terpene synthase-like protein 1 OS=Selaginella moellendorffii GN=SELMODRAFT_402353 PE=1 SV=2 64 326 1.0E-16
sp|Q82RR7|TPC1_STRAW Avermitilol synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tpc1 PE=1 SV=1 139 326 2.0E-16
sp|Q82IY4|PTLA_STRAW Pentalenene synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlA PE=1 SV=1 64 343 4.0E-16
sp|B5GS26|DCADS_STRC2 (-)-delta-cadinene synthase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=SCreLAV_p0328 PE=1 SV=1 38 324 1.0E-15
sp|Q9X839|CYC2_STRCO Germacradienol/geosmin synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cyc2 PE=1 SV=3 64 330 3.0E-15
sp|E3VWJ0|PNTA_STRAE Pentalenene synthase OS=Streptomyces arenae GN=pntA PE=3 SV=1 46 341 2.0E-14
sp|Q55012|PENA_STREX Pentalenene synthase OS=Streptomyces exfoliatus GN=penA PE=1 SV=4 56 345 2.0E-13
sp|J9R393|MTS13_SELML Microbial Terpene synthase-like protein 13 OS=Selaginella moellendorffii GN=SELMODRAFT_412537 PE=2 SV=2 22 326 2.0E-12
sp|Q9X839|CYC2_STRCO Germacradienol/geosmin synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cyc2 PE=1 SV=3 139 324 6.0E-12
sp|D8S255|MTS30_SELML Microbial Terpene synthase-like protein 30 OS=Selaginella moellendorffii GN=SELMODRAFT_417418 PE=2 SV=1 29 337 4.0E-10
sp|J9QS25|MTS26_SELML (E)-2-epi-beta-caryophyllene synthase OS=Selaginella moellendorffii GN=SELMODRAFT_414574 PE=1 SV=2 4 337 1.0E-09
sp|Q9K499|CYC1_STRCO Epi-isozizaene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cyc1 PE=1 SV=1 154 327 2.0E-08
sp|D8RNZ9|MTS22_SELML (3S,6E)-nerolidol synthase OS=Selaginella moellendorffii GN=SELMODRAFT_413294 PE=1 SV=1 150 326 2.0E-07
sp|B1W019|GCOA_STRGG (+)-caryolan-1-ol synthase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=gcoA PE=1 SV=1 49 289 3.0E-07
sp|A4FG19|MIBS_SACEN 2-methylisoborneol synthase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_3722 PE=1 SV=1 112 324 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0010333 terpene synthase activity Yes
GO:0000287 magnesium ion binding Yes
GO:0016829 lyase activity Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0016838 carbon-oxygen lyase activity, acting on phosphates No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016835 carbon-oxygen lyase activity No
GO:0003824 catalytic activity No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|112580
MGRAQLRQRPASFILPDLVAHCKYTLTYHTDGDDVAKQSVQWLDAGCPNLSPKQRRALHGLQAGELTAFCYNTAE
TGRLRIVSDFMNYLFHLDNISDGMMTRETSVLANAVMNALWCPDSFTPTEDCREELNPAKVARDFWSRCVKDCGP
GAQARFKETMGLFFEAVNIEAKARDNNKIPDLECYIDVRRDTSGCKPCWALIEYALDIDLPDFVAEDSVIRSLNQ
YTNDLVTWSNDIFSYNVEQARGDTHNMIVILMKYHNHTLQSAMDYVGNLCSETIDNFERLKGEVPSWGPEVDDMV
ARYIQGLQDWIVGSLHWSFQTKRYFGDRGETVKKERFVELLPSKSTKSHTSAIRSFINRITHPTWLPFRPSRSTI
SIPL*
Coding >AgabiH97|112580
ATGGGTCGTGCTCAACTTAGACAAAGGCCTGCTTCCTTTATCCTCCCTGACCTCGTTGCACACTGCAAGTACACG
CTCACTTATCATACCGATGGAGACGACGTTGCAAAGCAGTCTGTTCAATGGCTGGACGCTGGTTGTCCCAACCTC
AGTCCGAAGCAACGACGTGCTTTACATGGTCTCCAGGCCGGAGAACTTACCGCTTTCTGTTATAACACCGCGGAG
ACTGGGCGACTCCGCATTGTTTCTGATTTCATGAATTACTTATTCCACTTAGATAACATTAGCGATGGAATGATG
ACCCGCGAGACGAGTGTTCTTGCAAATGCTGTTATGAATGCCCTCTGGTGTCCCGATTCCTTTACTCCGACAGAA
GATTGCCGCGAGGAGCTCAACCCGGCCAAAGTTGCCAGAGATTTCTGGTCTCGTTGTGTCAAGGATTGCGGTCCT
GGTGCCCAGGCTCGGTTCAAGGAGACTATGGGCTTGTTCTTTGAAGCGGTGAATATTGAAGCCAAAGCCCGCGAT
AACAACAAAATACCAGATCTCGAATGTTACATTGACGTTCGGCGAGATACATCCGGCTGCAAACCTTGCTGGGCC
CTGATTGAATACGCTCTTGACATCGACCTCCCTGATTTTGTCGCTGAGGACTCGGTTATCCGTTCTCTCAACCAA
TATACTAACGACCTGGTCACTTGGTCTAATGACATTTTCTCTTACAATGTTGAGCAAGCCCGTGGGGATACGCAC
AACATGATTGTCATTCTGATGAAGTACCACAATCACACTCTCCAGAGTGCGATGGACTACGTTGGAAACTTGTGT
TCCGAGACTATCGATAACTTCGAGCGGCTAAAGGGTGAGGTCCCTTCTTGGGGACCTGAAGTTGATGATATGGTC
GCGCGTTATATTCAAGGCCTTCAAGATTGGATTGTCGGATCTCTTCATTGGAGTTTCCAGACTAAACGTTACTTC
GGTGACCGTGGCGAGACCGTCAAGAAAGAAAGATTTGTAGAACTGCTTCCCTCGAAATCCACGAAATCCCATACC
AGCGCAATTCGGTCATTCATCAATCGCATCACCCATCCTACATGGTTGCCATTCCGTCCCTCAAGATCTACTATA
TCCATTCCTCTCTAA
Transcript >AgabiH97|112580
ATGGGTCGTGCTCAACTTAGACAAAGGCCTGCTTCCTTTATCCTCCCTGACCTCGTTGCACACTGCAAGTACACG
CTCACTTATCATACCGATGGAGACGACGTTGCAAAGCAGTCTGTTCAATGGCTGGACGCTGGTTGTCCCAACCTC
AGTCCGAAGCAACGACGTGCTTTACATGGTCTCCAGGCCGGAGAACTTACCGCTTTCTGTTATAACACCGCGGAG
ACTGGGCGACTCCGCATTGTTTCTGATTTCATGAATTACTTATTCCACTTAGATAACATTAGCGATGGAATGATG
ACCCGCGAGACGAGTGTTCTTGCAAATGCTGTTATGAATGCCCTCTGGTGTCCCGATTCCTTTACTCCGACAGAA
GATTGCCGCGAGGAGCTCAACCCGGCCAAAGTTGCCAGAGATTTCTGGTCTCGTTGTGTCAAGGATTGCGGTCCT
GGTGCCCAGGCTCGGTTCAAGGAGACTATGGGCTTGTTCTTTGAAGCGGTGAATATTGAAGCCAAAGCCCGCGAT
AACAACAAAATACCAGATCTCGAATGTTACATTGACGTTCGGCGAGATACATCCGGCTGCAAACCTTGCTGGGCC
CTGATTGAATACGCTCTTGACATCGACCTCCCTGATTTTGTCGCTGAGGACTCGGTTATCCGTTCTCTCAACCAA
TATACTAACGACCTGGTCACTTGGTCTAATGACATTTTCTCTTACAATGTTGAGCAAGCCCGTGGGGATACGCAC
AACATGATTGTCATTCTGATGAAGTACCACAATCACACTCTCCAGAGTGCGATGGACTACGTTGGAAACTTGTGT
TCCGAGACTATCGATAACTTCGAGCGGCTAAAGGGTGAGGTCCCTTCTTGGGGACCTGAAGTTGATGATATGGTC
GCGCGTTATATTCAAGGCCTTCAAGATTGGATTGTCGGATCTCTTCATTGGAGTTTCCAGACTAAACGTTACTTC
GGTGACCGTGGCGAGACCGTCAAGAAAGAAAGATTTGTAGAACTGCTTCCCTCGAAATCCACGAAATCCCATACC
AGCGCAATTCGGTCATTCATCAATCGCATCACCCATCCTACATGGTTGCCATTCCGTCCCTCAAGATCTACTATA
TCCATTCCTCTCTAA
Gene >AgabiH97|112580
ATGGGTCGTGCTCAACTTAGACAAAGGCCTGCTTCCTTTATCCTCCCTGACCTCGTTGCACACTGCAAGTACACG
CTCACTTATCATACCGATGGAGACGACGTTGCAAAGCAGTCTGTTCAATGGCTGGACGCTGGTTGTCCCAACCTC
AGTCCGAAGCAACGACGTGCTTTACATGGTCTCCAGGCCGGAGAACTTACCGCTTTCTGTTATAACACCGCGGAG
ACTGGGCGACTCCGCATTGTTTCTGATTTCATGAATTACTTATTCCACTTGTAGGTCCTATGTTCTTTTTCTGTT
TATAATTGGGTCTTACTGGGCATTTAGAGATAACATTAGCGATGGAATGATGACCCGCGAGACGAGTGTTCTTGC
AAATGCTGTTATGAATGCCCTCTGGTGTCCCGATTCCTTTACTCCGACAGAAGATTGCCGCGAGGAGCTCAACCC
GGCCAAAGTTGCCAGAGAGTACGTCTTTTCCCTTTTATTAATTCTAAATATATTCTAATCGTCTACTTTAATAGT
TTCTGGTCTCGTTGTGTCAAGGATTGCGGTCCTGGTGCCCAGGCTCGGTTCAAGGAGACTATGGGCTTGTTCTTT
GAAGCGGTGAATATTGAAGCCAAAGCCCGCGATAACAACAAAATACCAGATCTCGAATGTTACATTGACGTTCGG
CGAGATACATCCGGTAAGTGATCCGATATCTTCGATTGTTCGCCTATCTAATTGTCTTCACGATCTCATAGGCTG
CAAACCTTGCTGGGCCCTGATTGAGTAAGTTGACGCTTCGGAAAGAATTTATCATAGATTAATTTGTTGTTTTTC
TTCAGATACGCTCTTGACATCGACCTCCCTGATTTTGTCGCTGAGGACTCGGTTATCCGTTCTCTCAACCAATAT
ACTAACGACCTGGTCACTTGGTCTAATGTAAGTCGCTATTCTACCGCTGATAAAATAAAGATGATGACTGACGTC
AATTTCTCAGGACATTTTCTCTTACAATGTTGAGCAAGCCCGTGGGGATACGCACAACATGATTGTCATTCTGAT
GAAGTACCACAATCACACTCTCCAGAGTGCGATGGACTACGTTGGAAACTTGTGTTCCGAGACTATCGATAACTT
CGAGCGGCTAAAGGGTGAGGTCCCTTCTTGGGGACCTGAAGTTGATGATATGGTCGCGCGTTATATTCAAGGCCT
TCAAGATTGGATTGTCGGGTAAGCCGTTATTTCGTGTTTTGCTTTTCGCGATTGCTGATGGCTGGCTTTTAGATC
TCTTCATTGGAGTTTCCAGACTAAACGTTACTTCGGTGACCGTGGCGAGACCGTCAAGAAAGAAAGATTTGTAGA
ACTGCTTCCCTCGAAATCCACGAAATCCCATACCAGCGCAATTCGGTCATTCATCAATCGCATCACCCATCCTAC
ATGGTTGCCATTCCGTCCCTCAAGATCTACTATATCCATTCCTCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail