Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|112460
Gene name
Locationscaffold_8:1669100..1670069
Strand-
Gene length (bp)969
Transcript length (bp)681
Coding sequence length (bp)681
Protein length (aa) 227

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 1.5E-74 9 221
PF13847 Methyltransf_31 Methyltransferase domain 6.2E-09 79 131
PF13649 Methyltransf_25 Methyltransferase domain 3.3E-07 84 163
PF08241 Methyltransf_11 Methyltransferase domain 3.4E-04 85 165
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.9E-04 80 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P80895|PIMT_PIG Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Sus scrofa GN=PCMT1 PE=1 SV=3 1 224 2.0E-79
sp|P22061|PIMT_HUMAN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens GN=PCMT1 PE=1 SV=4 1 224 6.0E-79
sp|Q5F3N1|PIMT_CHICK Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Gallus gallus GN=PCMT1 PE=2 SV=3 1 224 6.0E-79
sp|P15246|PIMT_BOVIN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Bos taurus GN=PCMT1 PE=1 SV=2 1 224 9.0E-79
sp|Q4R5H0|PIMT_MACFA Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Macaca fascicularis GN=PCMT1 PE=2 SV=3 1 224 2.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P80895|PIMT_PIG Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Sus scrofa GN=PCMT1 PE=1 SV=3 1 224 2.0E-79
sp|P22061|PIMT_HUMAN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens GN=PCMT1 PE=1 SV=4 1 224 6.0E-79
sp|Q5F3N1|PIMT_CHICK Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Gallus gallus GN=PCMT1 PE=2 SV=3 1 224 6.0E-79
sp|P15246|PIMT_BOVIN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Bos taurus GN=PCMT1 PE=1 SV=2 1 224 9.0E-79
sp|Q4R5H0|PIMT_MACFA Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Macaca fascicularis GN=PCMT1 PE=2 SV=3 1 224 2.0E-78
sp|Q5RA89|PIMT_PONAB Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Pongo abelii GN=PCMT1 PE=2 SV=3 1 224 3.0E-78
sp|Q92047|PIMT_DANRE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Danio rerio GN=pcmt PE=2 SV=3 1 224 5.0E-78
sp|P23506|PIMT_MOUSE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Mus musculus GN=Pcmt1 PE=1 SV=3 1 224 6.0E-78
sp|P22062|PIMT_RAT Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Rattus norvegicus GN=Pcmt1 PE=1 SV=2 1 224 2.0E-77
sp|Q27869|PIMT_DROME Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Drosophila melanogaster GN=Pcmt PE=1 SV=2 1 219 1.0E-73
sp|Q42539|PIMT1_ARATH Protein-L-isoaspartate O-methyltransferase 1 OS=Arabidopsis thaliana GN=PIMT1 PE=1 SV=3 10 223 4.0E-67
sp|Q27873|PIMT_CAEEL Protein-L-isoaspartate O-methyltransferase OS=Caenorhabditis elegans GN=pcm-1 PE=2 SV=1 1 224 7.0E-67
sp|Q9URZ1|PIMT_SCHPO Probable protein-L-isoaspartate O-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcm2 PE=3 SV=1 1 219 3.0E-65
sp|Q43209|PIMT_WHEAT Protein-L-isoaspartate O-methyltransferase OS=Triticum aestivum GN=PCM PE=1 SV=1 6 223 2.0E-64
sp|Q64J17|PIMT2_ARATH Protein-L-isoaspartate O-methyltransferase 2 OS=Arabidopsis thaliana GN=PIMT2 PE=1 SV=1 13 223 4.0E-64
sp|Q8TYL4|PIMT_METKA Protein-L-isoaspartate O-methyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pcm PE=3 SV=1 8 217 4.0E-44
sp|O27962|PIMT2_ARCFU Protein-L-isoaspartate O-methyltransferase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pcm2 PE=3 SV=1 25 217 1.0E-42
sp|A0B9U1|PIMT_METTP Protein-L-isoaspartate O-methyltransferase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pcm PE=3 SV=1 23 224 2.0E-41
sp|A2BKH8|PIMT_HYPBU Protein-L-isoaspartate O-methyltransferase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=pcm PE=3 SV=1 21 218 6.0E-40
sp|A8AAV7|PIMT_IGNH4 Protein-L-isoaspartate O-methyltransferase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=pcm PE=3 SV=1 8 221 2.0E-39
sp|Q9GPS6|PIMT_DICDI Probable protein-L-isoaspartate O-methyltransferase OS=Dictyostelium discoideum GN=pcmA PE=3 SV=1 28 224 2.0E-37
sp|Q8TT94|PIMT2_METAC Protein-L-isoaspartate O-methyltransferase 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pcm2 PE=3 SV=1 22 220 1.0E-36
sp|O59534|PIMT_PYRHO Protein-L-isoaspartate O-methyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pcm PE=3 SV=2 15 217 2.0E-36
sp|Q8PW90|PIMT_METMA Protein-L-isoaspartate O-methyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pcm PE=3 SV=1 20 220 3.0E-36
sp|A6UWM1|PIMT_META3 Protein-L-isoaspartate O-methyltransferase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pcm PE=3 SV=1 8 221 2.0E-35
sp|Q8TT93|PIMT1_METAC Protein-L-isoaspartate O-methyltransferase 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pcm1 PE=3 SV=1 17 220 3.0E-35
sp|A4G087|PIMT_METM5 Protein-L-isoaspartate O-methyltransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pcm PE=3 SV=1 13 221 9.0E-35
sp|A9A8I9|PIMT_METM6 Protein-L-isoaspartate O-methyltransferase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pcm PE=3 SV=1 16 221 1.0E-34
sp|C6A3F2|PIMT_THESM Protein-L-isoaspartate O-methyltransferase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=pcm PE=3 SV=1 13 217 2.0E-34
sp|B6YX51|PIMT_THEON Protein-L-isoaspartate O-methyltransferase OS=Thermococcus onnurineus (strain NA1) GN=pcm PE=3 SV=1 16 217 2.0E-34
sp|Q6M116|PIMT_METMP Protein-L-isoaspartate O-methyltransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=pcm PE=3 SV=1 13 221 3.0E-34
sp|A6UR90|PIMT_METVS Protein-L-isoaspartate O-methyltransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pcm PE=3 SV=1 13 220 6.0E-34
sp|A6VI91|PIMT_METM7 Protein-L-isoaspartate O-methyltransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pcm PE=3 SV=1 13 221 9.0E-34
sp|A1RSC6|PIMT_PYRIL Protein-L-isoaspartate O-methyltransferase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=pcm PE=3 SV=1 13 219 1.0E-33
sp|A3MY16|PIMT_PYRCJ Protein-L-isoaspartate O-methyltransferase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pcm PE=3 SV=1 11 219 2.0E-33
sp|O30199|PIMT1_ARCFU Protein-L-isoaspartate O-methyltransferase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pcm1 PE=3 SV=1 25 226 4.0E-33
sp|O26915|PIMT_METTH Protein-L-isoaspartate O-methyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pcm PE=3 SV=1 10 217 4.0E-33
sp|Q9YDA1|PIMT_AERPE Protein-L-isoaspartate O-methyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pcm PE=3 SV=2 3 217 7.0E-33
sp|Q57636|PIMT_METJA Protein-L-isoaspartate O-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pcm PE=1 SV=1 13 221 1.0E-32
sp|Q12UV0|PIMT_METBU Protein-L-isoaspartate O-methyltransferase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pcm PE=3 SV=1 27 220 4.0E-32
sp|Q0W2W0|PIMT_METAR Protein-L-isoaspartate O-methyltransferase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pcm PE=3 SV=1 32 217 6.0E-32
sp|Q8ZYN0|PIMT_PYRAE Protein-L-isoaspartate O-methyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pcm PE=1 SV=1 11 217 7.0E-32
sp|A7HL14|PIMT_FERNB Protein-L-isoaspartate O-methyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=pcm PE=3 SV=1 25 217 7.0E-32
sp|A3DMG3|PIMT_STAMF Protein-L-isoaspartate O-methyltransferase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=pcm PE=3 SV=1 10 217 9.0E-32
sp|Q2SKW3|PIMT_HAHCH Protein-L-isoaspartate O-methyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=pcm PE=3 SV=1 5 217 9.0E-32
sp|Q9UXX0|PIMT_PYRAB Protein-L-isoaspartate O-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pcm PE=3 SV=2 17 217 9.0E-32
sp|Q8TZR3|PIMT_PYRFU Protein-L-isoaspartate O-methyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pcm PE=1 SV=2 15 217 7.0E-31
sp|B4RZG8|PIMT_ALTMD Protein-L-isoaspartate O-methyltransferase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=pcm1 PE=3 SV=1 23 218 1.0E-30
sp|Q3JAW6|PIMT2_NITOC Protein-L-isoaspartate O-methyltransferase 2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=pcm2 PE=3 SV=1 27 218 4.0E-30
sp|Q7NJY2|PIMT_GLOVI Protein-L-isoaspartate O-methyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=pcm PE=3 SV=2 24 223 6.0E-30
sp|A3CXP8|PIMT_METMJ Protein-L-isoaspartate O-methyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pcm PE=3 SV=1 8 217 6.0E-30
sp|Q1I655|PIMT_PSEE4 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas entomophila (strain L48) GN=pcm PE=3 SV=2 6 219 9.0E-30
sp|Q88MF0|PIMT_PSEPK Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas putida (strain KT2440) GN=pcm PE=3 SV=2 6 219 2.0E-29
sp|B0KSC8|PIMT_PSEPG Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas putida (strain GB-1) GN=pcm PE=3 SV=2 6 219 2.0E-29
sp|A5W820|PIMT_PSEP1 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pcm PE=3 SV=2 6 219 2.0E-29
sp|Q48F88|PIMT_PSE14 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pcm PE=3 SV=2 6 219 2.0E-29
sp|Q4ZWP9|PIMT_PSEU2 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pcm PE=3 SV=2 6 219 3.0E-29
sp|Q886L4|PIMT_PSESM Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pcm PE=3 SV=1 6 219 4.0E-29
sp|A4WNC5|PIMT_PYRAR Protein-L-isoaspartate O-methyltransferase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=pcm PE=3 SV=1 11 217 4.0E-29
sp|Q0KB67|PIMT1_CUPNH Protein-L-isoaspartate O-methyltransferase 1 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pcm1 PE=3 SV=1 27 220 9.0E-29
sp|B1JB29|PIMT_PSEPW Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas putida (strain W619) GN=pcm PE=3 SV=2 6 219 2.0E-28
sp|B1L6T9|PIMT_KORCO Protein-L-isoaspartate O-methyltransferase OS=Korarchaeum cryptofilum (strain OPF8) GN=pcm PE=3 SV=1 10 220 2.0E-28
sp|A1WWY5|PIMT_HALHL Protein-L-isoaspartate O-methyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=pcm PE=3 SV=1 5 219 3.0E-28
sp|B1YC47|PIMT_PYRNV Protein-L-isoaspartate O-methyltransferase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=pcm PE=3 SV=1 13 219 5.0E-28
sp|Q3KH83|PIMT_PSEPF Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=pcm PE=3 SV=2 5 219 5.0E-28
sp|C3LS22|PIMT_VIBCM Protein-L-isoaspartate O-methyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=pcm PE=3 SV=1 12 221 6.0E-28
sp|Q9KUI8|PIMT_VIBCH Protein-L-isoaspartate O-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pcm PE=3 SV=1 12 221 6.0E-28
sp|A5F9C1|PIMT_VIBC3 Protein-L-isoaspartate O-methyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pcm PE=1 SV=1 12 221 6.0E-28
sp|B3EEX3|PIMT_CHLL2 Protein-L-isoaspartate O-methyltransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=pcm PE=3 SV=1 12 221 7.0E-28
sp|A6LNM3|PIMT_THEM4 Protein-L-isoaspartate O-methyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=pcm PE=3 SV=1 25 218 1.0E-27
sp|Q4KHE7|PIMT_PSEF5 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pcm PE=3 SV=2 5 219 1.0E-27
sp|A4VJV3|PIMT_PSEU5 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=pcm PE=3 SV=2 5 219 3.0E-27
sp|A5UZW2|PIMT_ROSS1 Protein-L-isoaspartate O-methyltransferase OS=Roseiflexus sp. (strain RS-1) GN=pcm PE=3 SV=1 17 217 4.0E-27
sp|Q1D6W9|PIMT_MYXXD Protein-L-isoaspartate O-methyltransferase OS=Myxococcus xanthus (strain DK 1622) GN=pcm PE=3 SV=1 17 218 7.0E-27
sp|C3K706|PIMT_PSEFS Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=pcm PE=3 SV=1 5 219 8.0E-27
sp|A4XWR1|PIMT_PSEMY Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas mendocina (strain ymp) GN=pcm PE=3 SV=2 5 219 8.0E-27
sp|Q123X2|PIMT2_POLSJ Protein-L-isoaspartate O-methyltransferase 2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pcm2 PE=3 SV=1 26 218 8.0E-27
sp|Q7N8K3|PIMT_PHOLL Protein-L-isoaspartate O-methyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pcm PE=3 SV=1 8 219 1.0E-26
sp|Q7NRV0|PIMT_CHRVO Protein-L-isoaspartate O-methyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pcm PE=3 SV=1 5 217 1.0E-26
sp|Q487E5|PIMT_COLP3 Protein-L-isoaspartate O-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pcm PE=3 SV=1 1 221 3.0E-26
sp|A0LM89|PIMT2_SYNFM Protein-L-isoaspartate O-methyltransferase 2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=pcm2 PE=3 SV=1 27 218 3.0E-26
sp|B8J9E3|PIMT_ANAD2 Protein-L-isoaspartate O-methyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=pcm PE=3 SV=1 10 218 4.0E-26
sp|C6DDF9|PIMT_PECCP Protein-L-isoaspartate O-methyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pcm PE=3 SV=1 8 218 8.0E-26
sp|A7HXK6|PIMT_PARL1 Protein-L-isoaspartate O-methyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=pcm PE=3 SV=1 12 219 1.0E-25
sp|A6V1G4|PIMT_PSEA7 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=pcm PE=3 SV=2 5 219 1.0E-25
sp|Q6D1B6|PIMT_PECAS Protein-L-isoaspartate O-methyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pcm PE=3 SV=1 13 218 1.0E-25
sp|Q15P27|PIMT_PSEA6 Protein-L-isoaspartate O-methyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pcm PE=3 SV=1 4 221 2.0E-25
sp|A1ASW6|PIMT2_PELPD Protein-L-isoaspartate O-methyltransferase 2 OS=Pelobacter propionicus (strain DSM 2379) GN=pcm2 PE=3 SV=1 28 218 2.0E-25
sp|A1JJT8|PIMT_YERE8 Protein-L-isoaspartate O-methyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pcm PE=3 SV=1 7 217 3.0E-25
sp|A8H1T1|PIMT_SHEPA Protein-L-isoaspartate O-methyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=pcm PE=3 SV=1 15 219 3.0E-25
sp|A0KGH9|PIMT_AERHH Protein-L-isoaspartate O-methyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pcm PE=3 SV=1 14 221 4.0E-25
sp|A1TZ54|PIMT1_MARHV Protein-L-isoaspartate O-methyltransferase 1 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pcm1 PE=3 SV=1 5 217 4.0E-25
sp|A7I4W9|PIMT_METB6 Protein-L-isoaspartate O-methyltransferase OS=Methanoregula boonei (strain 6A8) GN=pcm PE=3 SV=1 15 217 4.0E-25
sp|Q47D25|PIMT_DECAR Protein-L-isoaspartate O-methyltransferase OS=Dechloromonas aromatica (strain RCB) GN=pcm PE=3 SV=1 6 222 5.0E-25
sp|P45683|PIMT_PSEAE Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcm PE=3 SV=2 5 219 5.0E-25
sp|Q02R96|PIMT_PSEAB Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pcm PE=3 SV=1 5 219 5.0E-25
sp|B7V8C3|PIMT_PSEA8 Protein-L-isoaspartate O-methyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=pcm PE=3 SV=1 5 219 5.0E-25
sp|Q74CZ5|PIMT_GEOSL Protein-L-isoaspartate O-methyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=pcm PE=3 SV=2 27 218 1.0E-24
sp|A5G4S7|PIMT2_GEOUR Protein-L-isoaspartate O-methyltransferase 2 OS=Geobacter uraniireducens (strain Rf4) GN=pcm2 PE=3 SV=1 23 220 1.0E-24
sp|B5XV38|PIMT_KLEP3 Protein-L-isoaspartate O-methyltransferase OS=Klebsiella pneumoniae (strain 342) GN=pcm PE=3 SV=1 12 218 2.0E-24
sp|Q6LMT7|PIMT_PHOPR Protein-L-isoaspartate O-methyltransferase OS=Photobacterium profundum GN=pcm PE=3 SV=1 7 221 2.0E-24
sp|A6TD35|PIMT_KLEP7 Protein-L-isoaspartate O-methyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pcm PE=3 SV=1 12 218 2.0E-24
sp|Q2IIL9|PIMT_ANADE Protein-L-isoaspartate O-methyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pcm PE=3 SV=1 10 218 3.0E-24
sp|B1ZPF0|PIMT_OPITP Protein-L-isoaspartate O-methyltransferase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=pcm PE=3 SV=1 31 218 5.0E-24
sp|A1VD15|PIMT_DESVV Protein-L-isoaspartate O-methyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=pcm PE=3 SV=2 8 218 5.0E-24
sp|Q72AZ1|PIMT_DESVH Protein-L-isoaspartate O-methyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=pcm PE=3 SV=1 8 218 5.0E-24
sp|A7HC32|PIMT1_ANADF Protein-L-isoaspartate O-methyltransferase 1 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=pcm1 PE=3 SV=1 8 218 7.0E-24
sp|B8DJP7|PIMT_DESVM Protein-L-isoaspartate O-methyltransferase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=pcm PE=3 SV=1 8 218 8.0E-24
sp|Q2NVM1|PIMT_SODGM Protein-L-isoaspartate O-methyltransferase OS=Sodalis glossinidius (strain morsitans) GN=pcm PE=3 SV=1 13 218 8.0E-24
sp|A1S4E3|PIMT_SHEAM Protein-L-isoaspartate O-methyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=pcm PE=3 SV=1 8 219 9.0E-24
sp|Q3BUS3|PIMT_XANC5 Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pcm PE=3 SV=1 5 217 9.0E-24
sp|A4SRB5|PIMT_AERS4 Protein-L-isoaspartate O-methyltransferase OS=Aeromonas salmonicida (strain A449) GN=pcm PE=3 SV=1 14 221 1.0E-23
sp|Q2FRW3|PIMT_METHJ Protein-L-isoaspartate O-methyltransferase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pcm PE=3 SV=1 24 217 1.0E-23
sp|B8CJQ2|PIMT_SHEPW Protein-L-isoaspartate O-methyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=pcm PE=3 SV=1 15 219 1.0E-23
sp|Q2YCR1|PIMT1_NITMU Protein-L-isoaspartate O-methyltransferase 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=pcm1 PE=3 SV=1 28 217 1.0E-23
sp|B5FAF3|PIMT_VIBFM Protein-L-isoaspartate O-methyltransferase OS=Vibrio fischeri (strain MJ11) GN=pcm PE=3 SV=1 9 218 1.0E-23
sp|B2FK95|PIMT_STRMK Protein-L-isoaspartate O-methyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=pcm PE=3 SV=1 5 217 1.0E-23
sp|A8G9Z6|PIMT_SERP5 Protein-L-isoaspartate O-methyltransferase OS=Serratia proteamaculans (strain 568) GN=pcm PE=3 SV=1 7 217 1.0E-23
sp|Q39VS0|PIMT_GEOMG Protein-L-isoaspartate O-methyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pcm PE=3 SV=1 24 218 1.0E-23
sp|B2VG25|PIMT_ERWT9 Protein-L-isoaspartate O-methyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pcm PE=3 SV=1 6 221 2.0E-23
sp|Q2J302|PIMT1_RHOP2 Protein-L-isoaspartate O-methyltransferase 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=pcm1 PE=3 SV=1 28 224 2.0E-23
sp|B0TK10|PIMT_SHEHH Protein-L-isoaspartate O-methyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=pcm PE=3 SV=1 15 219 2.0E-23
sp|B1XQE1|PIMT_SYNP2 Protein-L-isoaspartate O-methyltransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=pcm PE=3 SV=1 47 217 2.0E-23
sp|B1JJF4|PIMT_YERPY Protein-L-isoaspartate O-methyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pcm PE=3 SV=1 7 218 3.0E-23
sp|Q66EB9|PIMT_YERPS Protein-L-isoaspartate O-methyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pcm PE=3 SV=1 7 218 3.0E-23
sp|A4TQ01|PIMT_YERPP Protein-L-isoaspartate O-methyltransferase OS=Yersinia pestis (strain Pestoides F) GN=pcm PE=3 SV=1 7 218 3.0E-23
sp|Q1CLR2|PIMT_YERPN Protein-L-isoaspartate O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pcm PE=3 SV=1 7 218 3.0E-23
sp|A9R115|PIMT_YERPG Protein-L-isoaspartate O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pcm PE=3 SV=1 7 218 3.0E-23
sp|Q8ZBQ0|PIMT_YERPE Protein-L-isoaspartate O-methyltransferase OS=Yersinia pestis GN=pcm PE=3 SV=1 7 218 3.0E-23
sp|B2K581|PIMT_YERPB Protein-L-isoaspartate O-methyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pcm PE=3 SV=1 7 218 3.0E-23
sp|Q1C474|PIMT_YERPA Protein-L-isoaspartate O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pcm PE=3 SV=1 7 218 3.0E-23
sp|A7FLX4|PIMT_YERP3 Protein-L-isoaspartate O-methyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pcm PE=3 SV=1 7 218 3.0E-23
sp|Q8P9Y6|PIMT_XANCP Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pcm PE=3 SV=1 5 217 3.0E-23
sp|B0RTZ8|PIMT_XANCB Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=pcm PE=3 SV=1 5 217 3.0E-23
sp|Q4UTP9|PIMT_XANC8 Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pcm PE=3 SV=1 5 217 3.0E-23
sp|A0KU88|PIMT_SHESA Protein-L-isoaspartate O-methyltransferase OS=Shewanella sp. (strain ANA-3) GN=pcm PE=3 SV=1 15 219 3.0E-23
sp|Q8PLR3|PIMT_XANAC Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pcm PE=3 SV=1 5 217 3.0E-23
sp|B3PJA8|PIMT_CELJU Protein-L-isoaspartate O-methyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=pcm PE=3 SV=1 5 217 3.0E-23
sp|A5CYQ6|PIMT_PELTS Protein-L-isoaspartate O-methyltransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=pcm PE=3 SV=1 6 218 4.0E-23
sp|A7NI01|PIMT_ROSCS Protein-L-isoaspartate O-methyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=pcm PE=3 SV=1 13 217 4.0E-23
sp|Q0HXG4|PIMT_SHESR Protein-L-isoaspartate O-methyltransferase OS=Shewanella sp. (strain MR-7) GN=pcm PE=3 SV=1 15 219 5.0E-23
sp|Q0HL66|PIMT_SHESM Protein-L-isoaspartate O-methyltransferase OS=Shewanella sp. (strain MR-4) GN=pcm PE=3 SV=1 15 219 5.0E-23
sp|A5G6S0|PIMT3_GEOUR Protein-L-isoaspartate O-methyltransferase 3 OS=Geobacter uraniireducens (strain Rf4) GN=pcm3 PE=3 SV=1 8 223 5.0E-23
sp|A1RHF9|PIMT_SHESW Protein-L-isoaspartate O-methyltransferase OS=Shewanella sp. (strain W3-18-1) GN=pcm PE=3 SV=1 15 219 5.0E-23
sp|A4Y937|PIMT_SHEPC Protein-L-isoaspartate O-methyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pcm PE=3 SV=1 15 219 5.0E-23
sp|A7MJ61|PIMT_CROS8 Protein-L-isoaspartate O-methyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pcm PE=3 SV=1 12 218 6.0E-23
sp|Q87LQ6|PIMT_VIBPA Protein-L-isoaspartate O-methyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pcm PE=3 SV=1 12 221 6.0E-23
sp|B7LWJ2|PIMT_ESCF3 Protein-L-isoaspartate O-methyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pcm PE=3 SV=1 13 218 7.0E-23
sp|Q8EBR6|PIMT_SHEON Protein-L-isoaspartate O-methyltransferase OS=Shewanella oneidensis (strain MR-1) GN=pcm PE=3 SV=1 15 219 8.0E-23
sp|Q1H095|PIMT_METFK Protein-L-isoaspartate O-methyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=pcm PE=3 SV=1 5 217 8.0E-23
sp|Q5E332|PIMT_VIBF1 Protein-L-isoaspartate O-methyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pcm PE=3 SV=1 9 218 8.0E-23
sp|Q3YYB9|PIMT_SHISS Protein-L-isoaspartate O-methyltransferase OS=Shigella sonnei (strain Ss046) GN=pcm PE=3 SV=1 13 218 8.0E-23
sp|A5GEF7|PIMT1_GEOUR Protein-L-isoaspartate O-methyltransferase 1 OS=Geobacter uraniireducens (strain Rf4) GN=pcm1 PE=3 SV=1 28 217 9.0E-23
sp|Q086A4|PIMT_SHEFN Protein-L-isoaspartate O-methyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=pcm PE=3 SV=1 4 221 9.0E-23
sp|Q21LB7|PIMT_SACD2 Protein-L-isoaspartate O-methyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=pcm PE=3 SV=1 5 217 9.0E-23
sp|Q5QUB2|PIMT_IDILO Protein-L-isoaspartate O-methyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pcm PE=3 SV=1 6 221 9.0E-23
sp|Q0T1H4|PIMT_SHIF8 Protein-L-isoaspartate O-methyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|Q32CI7|PIMT_SHIDS Protein-L-isoaspartate O-methyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|Q31XA5|PIMT_SHIBS Protein-L-isoaspartate O-methyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|B2TZI8|PIMT_SHIB3 Protein-L-isoaspartate O-methyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|B1LQ63|PIMT_ECOSM Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|B6I6D3|PIMT_ECOSE Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain SE11) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|B7N6X3|PIMT_ECOLU Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|P0A7A5|PIMT_ECOLI Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain K12) GN=pcm PE=1 SV=2 13 218 1.0E-22
sp|B1IUT6|PIMT_ECOLC Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|A8A3M2|PIMT_ECOHS Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|B1XCR9|PIMT_ECODH Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|C4ZZP7|PIMT_ECOBW Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|B7LXF5|PIMT_ECO8A Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O8 (strain IAI1) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|B5Z3A5|PIMT_ECO5E Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|P0A7A6|PIMT_ECO57 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O157:H7 GN=pcm PE=3 SV=2 13 218 1.0E-22
sp|B7LEG1|PIMT_ECO55 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|B7UHG2|PIMT_ECO27 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|A7ZQI7|PIMT_ECO24 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pcm PE=3 SV=1 13 218 1.0E-22
sp|B6EKL2|PIMT_ALISL Protein-L-isoaspartate O-methyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=pcm PE=3 SV=1 9 221 1.0E-22
sp|B4SR93|PIMT_STRM5 Protein-L-isoaspartate O-methyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=pcm PE=3 SV=1 5 217 1.0E-22
sp|Q3A4N4|PIMT_PELCD Protein-L-isoaspartate O-methyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pcm PE=3 SV=1 28 220 1.0E-22
sp|B7NT87|PIMT_ECO7I Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pcm PE=3 SV=1 23 218 2.0E-22
sp|A7HHV3|PIMT2_ANADF Protein-L-isoaspartate O-methyltransferase 2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=pcm2 PE=3 SV=2 2 217 3.0E-22
sp|A6X6Y1|PIMT_OCHA4 Protein-L-isoaspartate O-methyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pcm PE=3 SV=1 8 225 3.0E-22
sp|B3E6I4|PIMT_GEOLS Protein-L-isoaspartate O-methyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=pcm PE=3 SV=1 46 226 3.0E-22
sp|B1KPT0|PIMT_SHEWM Protein-L-isoaspartate O-methyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pcm PE=3 SV=1 15 219 3.0E-22
sp|Q83JY3|PIMT_SHIFL Protein-L-isoaspartate O-methyltransferase OS=Shigella flexneri GN=pcm PE=3 SV=3 13 218 3.0E-22
sp|Q8ZMF9|PIMT_SALTY Protein-L-isoaspartate O-methyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pcm PE=3 SV=1 5 218 3.0E-22
sp|C0PXA3|PIMT_SALPC Protein-L-isoaspartate O-methyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=pcm PE=3 SV=1 5 218 3.0E-22
sp|A9N1H6|PIMT_SALPB Protein-L-isoaspartate O-methyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pcm PE=3 SV=2 5 218 3.0E-22
sp|B4T453|PIMT_SALNS Protein-L-isoaspartate O-methyltransferase OS=Salmonella newport (strain SL254) GN=pcm PE=3 SV=1 5 218 3.0E-22
sp|B4TFW3|PIMT_SALHS Protein-L-isoaspartate O-methyltransferase OS=Salmonella heidelberg (strain SL476) GN=pcm PE=3 SV=1 5 218 3.0E-22
sp|B5RDP9|PIMT_SALG2 Protein-L-isoaspartate O-methyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pcm PE=3 SV=1 5 218 3.0E-22
sp|B5QW14|PIMT_SALEP Protein-L-isoaspartate O-methyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=pcm PE=3 SV=1 5 218 3.0E-22
sp|B5FTS1|PIMT_SALDC Protein-L-isoaspartate O-methyltransferase OS=Salmonella dublin (strain CT_02021853) GN=pcm PE=3 SV=1 5 218 3.0E-22
sp|Q57KJ8|PIMT_SALCH Protein-L-isoaspartate O-methyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=pcm PE=3 SV=1 5 218 3.0E-22
sp|B5F407|PIMT_SALA4 Protein-L-isoaspartate O-methyltransferase OS=Salmonella agona (strain SL483) GN=pcm PE=3 SV=1 5 218 3.0E-22
sp|Q1R7U8|PIMT_ECOUT Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=pcm PE=3 SV=1 13 218 4.0E-22
sp|Q8FEJ8|PIMT_ECOL6 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pcm PE=3 SV=3 13 218 4.0E-22
sp|A1AET7|PIMT_ECOK1 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O1:K1 / APEC GN=pcm PE=3 SV=1 13 218 4.0E-22
sp|B7MZ44|PIMT_ECO81 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O81 (strain ED1a) GN=pcm PE=3 SV=1 13 218 4.0E-22
sp|B7MKL7|PIMT_ECO45 Protein-L-isoaspartate O-methyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pcm PE=3 SV=1 13 218 4.0E-22
sp|A6WR22|PIMT_SHEB8 Protein-L-isoaspartate O-methyltransferase OS=Shewanella baltica (strain OS185) GN=pcm PE=3 SV=1 15 219 5.0E-22
sp|A3D789|PIMT_SHEB5 Protein-L-isoaspartate O-methyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=pcm PE=3 SV=1 15 219 5.0E-22
sp|B8E8T7|PIMT_SHEB2 Protein-L-isoaspartate O-methyltransferase OS=Shewanella baltica (strain OS223) GN=pcm PE=3 SV=1 15 219 5.0E-22
sp|Q8Z474|PIMT_SALTI Protein-L-isoaspartate O-methyltransferase OS=Salmonella typhi GN=pcm PE=3 SV=1 5 218 1.0E-21
sp|B4TTV7|PIMT_SALSV Protein-L-isoaspartate O-methyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=pcm PE=3 SV=1 5 218 1.0E-21
sp|B5BEY0|PIMT_SALPK Protein-L-isoaspartate O-methyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=pcm PE=3 SV=1 5 218 1.0E-21
sp|Q5PEE9|PIMT_SALPA Protein-L-isoaspartate O-methyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pcm PE=3 SV=1 5 218 1.0E-21
sp|Q5GYL2|PIMT_XANOR Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pcm PE=3 SV=1 5 217 1.0E-21
sp|B2SUB3|PIMT_XANOP Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=pcm PE=3 SV=1 5 217 1.0E-21
sp|Q2P1L5|PIMT_XANOM Protein-L-isoaspartate O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pcm PE=3 SV=1 5 217 1.0E-21
sp|A9KYG4|PIMT_SHEB9 Protein-L-isoaspartate O-methyltransferase OS=Shewanella baltica (strain OS195) GN=pcm PE=3 SV=1 15 219 1.0E-21
sp|B4F223|PIMT_PROMH Protein-L-isoaspartate O-methyltransferase OS=Proteus mirabilis (strain HI4320) GN=pcm PE=3 SV=1 8 217 1.0E-21
sp|A9MF32|PIMT_SALAR Protein-L-isoaspartate O-methyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pcm PE=3 SV=1 13 218 1.0E-21
sp|A9AUP1|PIMT_HERA2 Protein-L-isoaspartate O-methyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=pcm PE=3 SV=1 26 217 2.0E-21
sp|A8FST4|PIMT1_SHESH Protein-L-isoaspartate O-methyltransferase 1 OS=Shewanella sediminis (strain HAW-EB3) GN=pcm1 PE=3 SV=1 15 219 2.0E-21
sp|A8ANV7|PIMT_CITK8 Protein-L-isoaspartate O-methyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pcm PE=3 SV=1 13 218 2.0E-21
sp|Q87AK5|PIMT_XYLFT Protein-L-isoaspartate O-methyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pcm PE=3 SV=1 5 217 3.0E-21
sp|B2I8X8|PIMT_XYLF2 Protein-L-isoaspartate O-methyltransferase OS=Xylella fastidiosa (strain M23) GN=pcm PE=3 SV=1 5 217 3.0E-21
sp|Q2L008|PIMT_BORA1 Protein-L-isoaspartate O-methyltransferase OS=Bordetella avium (strain 197N) GN=pcm PE=3 SV=1 6 217 3.0E-21
sp|B0U4U6|PIMT_XYLFM Protein-L-isoaspartate O-methyltransferase OS=Xylella fastidiosa (strain M12) GN=pcm PE=3 SV=1 6 217 3.0E-21
sp|Q7MHQ8|PIMT_VIBVY Protein-L-isoaspartate O-methyltransferase OS=Vibrio vulnificus (strain YJ016) GN=pcm PE=3 SV=1 6 221 3.0E-21
sp|Q8DC56|PIMT_VIBVU Protein-L-isoaspartate O-methyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=pcm PE=3 SV=1 6 221 3.0E-21
sp|C6BTT9|PIMT_DESAD Protein-L-isoaspartate O-methyltransferase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=pcm PE=3 SV=1 28 224 3.0E-21
sp|A7MTT6|PIMT_VIBCB Protein-L-isoaspartate O-methyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pcm PE=3 SV=1 13 221 5.0E-21
sp|A4SGH4|PIMT_CHLPM Protein-L-isoaspartate O-methyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=pcm PE=3 SV=1 8 221 6.0E-21
sp|B7VK62|PIMT_VIBTL Protein-L-isoaspartate O-methyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=pcm PE=3 SV=1 5 218 6.0E-21
sp|A1ASL8|PIMT1_PELPD Protein-L-isoaspartate O-methyltransferase 1 OS=Pelobacter propionicus (strain DSM 2379) GN=pcm1 PE=3 SV=1 16 224 6.0E-21
sp|B4SFU3|PIMT_PELPB Protein-L-isoaspartate O-methyltransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=pcm PE=3 SV=1 10 221 7.0E-21
sp|Q2RTH7|PIMT_RHORT Protein-L-isoaspartate O-methyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pcm PE=3 SV=1 12 219 9.0E-21
sp|Q9PF21|PIMT_XYLFA Protein-L-isoaspartate O-methyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=pcm PE=3 SV=1 5 217 9.0E-21
sp|Q7W671|PIMT_BORPA Protein-L-isoaspartate O-methyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pcm PE=3 SV=1 6 217 2.0E-20
sp|Q7WI37|PIMT_BORBR Protein-L-isoaspartate O-methyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pcm PE=3 SV=2 6 217 2.0E-20
sp|Q1MRE5|PIMT_LAWIP Protein-L-isoaspartate O-methyltransferase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=pcm PE=3 SV=1 13 224 2.0E-20
sp|A4WDU8|PIMT_ENT38 Protein-L-isoaspartate O-methyltransferase OS=Enterobacter sp. (strain 638) GN=pcm PE=3 SV=1 14 218 3.0E-20
sp|Q0A7L5|PIMT_ALKEH Protein-L-isoaspartate O-methyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=pcm PE=3 SV=1 5 217 3.0E-20
sp|A0LZ51|PIMT_GRAFK Protein-L-isoaspartate O-methyltransferase OS=Gramella forsetii (strain KT0803) GN=pcm PE=3 SV=1 2 219 5.0E-20
sp|Q0VQD1|PIMT_ALCBS Protein-L-isoaspartate O-methyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pcm PE=3 SV=1 6 217 5.0E-20
sp|A1BDC1|PIMT_CHLPD Protein-L-isoaspartate O-methyltransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=pcm PE=3 SV=1 10 221 5.0E-20
sp|A4YV66|PIMT_BRASO Protein-L-isoaspartate O-methyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=pcm PE=3 SV=1 28 216 5.0E-20
sp|Q3JCZ3|PIMT1_NITOC Protein-L-isoaspartate O-methyltransferase 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=pcm1 PE=3 SV=1 8 217 6.0E-20
sp|Q2JJN4|PIMT_SYNJB Protein-L-isoaspartate O-methyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=pcm PE=3 SV=1 16 187 6.0E-20
sp|Q30ZM2|PIMT_DESAG Protein-L-isoaspartate O-methyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=pcm PE=3 SV=1 28 218 6.0E-20
sp|A3QC83|PIMT_SHELP Protein-L-isoaspartate O-methyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pcm PE=3 SV=2 43 219 7.0E-20
sp|Q11TS0|PIMT_CYTH3 Protein-L-isoaspartate O-methyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=pcm PE=3 SV=1 26 221 8.0E-20
sp|B3ELJ9|PIMT_CHLPB Protein-L-isoaspartate O-methyltransferase OS=Chlorobium phaeobacteroides (strain BS1) GN=pcm PE=3 SV=1 4 221 8.0E-20
sp|Q8KFW8|PIMT_CHLTE Protein-L-isoaspartate O-methyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=pcm PE=3 SV=1 8 221 8.0E-20
sp|Q12PY8|PIMT_SHEDO Protein-L-isoaspartate O-methyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pcm PE=3 SV=1 11 219 8.0E-20
sp|A2SF76|PIMT_METPP Protein-L-isoaspartate O-methyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=pcm PE=3 SV=1 9 217 1.0E-19
sp|B3QQM1|PIMT_CHLP8 Protein-L-isoaspartate O-methyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=pcm PE=3 SV=1 14 225 2.0E-19
sp|A9IP04|PIMT_BORPD Protein-L-isoaspartate O-methyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=pcm PE=3 SV=1 6 217 2.0E-19
sp|A0LL58|PIMT1_SYNFM Protein-L-isoaspartate O-methyltransferase 1 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=pcm1 PE=3 SV=1 27 187 2.0E-19
sp|A1U4P7|PIMT2_MARHV Protein-L-isoaspartate O-methyltransferase 2 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pcm2 PE=3 SV=1 27 225 2.0E-19
sp|A8I4G3|PIMT_AZOC5 Protein-L-isoaspartate O-methyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=pcm PE=3 SV=2 10 218 2.0E-19
sp|A7INP1|PIMT_XANP2 Protein-L-isoaspartate O-methyltransferase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=pcm PE=3 SV=1 13 217 3.0E-19
sp|Q0ADP2|PIMT_NITEC Protein-L-isoaspartate O-methyltransferase OS=Nitrosomonas eutropha (strain C91) GN=pcm PE=3 SV=1 6 216 3.0E-19
sp|A1B5M0|PIMT_PARDP Protein-L-isoaspartate O-methyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=pcm PE=3 SV=1 27 219 3.0E-19
sp|Q6MCW9|PIMT_PARUW Protein-L-isoaspartate O-methyltransferase OS=Protochlamydia amoebophila (strain UWE25) GN=pcm PE=3 SV=1 16 221 3.0E-19
sp|A5EJV5|PIMT_BRASB Protein-L-isoaspartate O-methyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pcm PE=3 SV=1 15 216 3.0E-19
sp|Q82VW0|PIMT_NITEU Protein-L-isoaspartate O-methyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=pcm PE=3 SV=1 6 216 4.0E-19
sp|B8E0T1|PIMT_DICTD Protein-L-isoaspartate O-methyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=pcm PE=3 SV=1 8 217 4.0E-19
sp|Q6ARM1|PIMT_DESPS Protein-L-isoaspartate O-methyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=pcm PE=3 SV=1 43 218 5.0E-19
sp|Q3B1L6|PIMT_CHLL7 Protein-L-isoaspartate O-methyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=pcm PE=3 SV=1 10 221 5.0E-19
sp|B6JFP0|PIMT_OLICO Protein-L-isoaspartate O-methyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=pcm PE=3 SV=1 6 216 5.0E-19
sp|Q1QU77|PIMT_CHRSD Protein-L-isoaspartate O-methyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pcm PE=3 SV=1 6 219 5.0E-19
sp|Q163U2|PIMT_ROSDO Protein-L-isoaspartate O-methyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=pcm PE=3 SV=1 27 219 6.0E-19
sp|B5YF00|PIMT_DICT6 Protein-L-isoaspartate O-methyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=pcm PE=3 SV=1 14 217 6.0E-19
sp|A9BH07|PIMT_PETMO Protein-L-isoaspartate O-methyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=pcm PE=3 SV=1 16 217 6.0E-19
sp|A9VY77|PIMT_METEP Protein-L-isoaspartate O-methyltransferase OS=Methylobacterium extorquens (strain PA1) GN=pcm PE=3 SV=1 28 217 6.0E-19
sp|B2A578|PIMT_NATTJ Protein-L-isoaspartate O-methyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=pcm PE=3 SV=1 1 217 7.0E-19
sp|B8J017|PIMT_DESDA Protein-L-isoaspartate O-methyltransferase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=pcm PE=3 SV=1 28 224 9.0E-19
sp|Q3SKJ2|PIMT_THIDA Protein-L-isoaspartate O-methyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=pcm PE=3 SV=1 6 217 1.0E-18
sp|Q2W4A2|PIMT_MAGSA Protein-L-isoaspartate O-methyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pcm PE=3 SV=1 12 219 1.0E-18
sp|Q1INS6|PIMT_KORVE Protein-L-isoaspartate O-methyltransferase OS=Koribacter versatilis (strain Ellin345) GN=pcm PE=3 SV=1 16 217 2.0E-18
sp|A8FX24|PIMT2_SHESH Protein-L-isoaspartate O-methyltransferase 2 OS=Shewanella sediminis (strain HAW-EB3) GN=pcm2 PE=3 SV=1 8 218 2.0E-18
sp|Q2YBR7|PIMT2_NITMU Protein-L-isoaspartate O-methyltransferase 2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=pcm2 PE=3 SV=1 6 217 2.0E-18
sp|A6H0V1|PIMT_FLAPJ Protein-L-isoaspartate O-methyltransferase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=pcm PE=3 SV=1 47 219 2.0E-18
sp|A4WU05|PIMT_RHOS5 Protein-L-isoaspartate O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=pcm PE=3 SV=1 27 219 3.0E-18
sp|Q3IDD2|PIMT_PSEHT Protein-L-isoaspartate O-methyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pcm PE=3 SV=1 39 221 3.0E-18
sp|B0T1Q1|PIMT_CAUSK Protein-L-isoaspartate O-methyltransferase OS=Caulobacter sp. (strain K31) GN=pcm PE=3 SV=1 13 219 4.0E-18
sp|B6ISM3|PIMT_RHOCS Protein-L-isoaspartate O-methyltransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=pcm PE=3 SV=1 12 217 5.0E-18
sp|B1ZJW1|PIMT_METPB Protein-L-isoaspartate O-methyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=pcm PE=3 SV=1 31 217 5.0E-18
sp|Q39FP9|PIMT_BURL3 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=pcm PE=3 SV=1 2 217 6.0E-18
sp|Q2LUT4|PIMT_SYNAS Protein-L-isoaspartate O-methyltransferase OS=Syntrophus aciditrophicus (strain SB) GN=pcm PE=3 SV=1 27 187 7.0E-18
sp|A4JEQ0|PIMT_BURVG Protein-L-isoaspartate O-methyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=pcm PE=3 SV=1 5 217 1.0E-17
sp|Q1GFP1|PIMT_RUEST Protein-L-isoaspartate O-methyltransferase OS=Ruegeria sp. (strain TM1040) GN=pcm PE=3 SV=1 8 219 1.0E-17
sp|Q63UU3|PIMT_BURPS Protein-L-isoaspartate O-methyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=pcm PE=3 SV=1 5 217 1.0E-17
sp|Q3JRP1|PIMT_BURP1 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=pcm PE=3 SV=1 5 217 1.0E-17
sp|A3NVY1|PIMT_BURP0 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=pcm PE=3 SV=1 5 217 1.0E-17
sp|A8ZXR8|PIMT_DESOH Protein-L-isoaspartate O-methyltransferase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=pcm PE=3 SV=1 46 217 1.0E-17
sp|A3NA64|PIMT_BURP6 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia pseudomallei (strain 668) GN=pcm PE=3 SV=1 5 217 1.0E-17
sp|B1JTA2|PIMT_BURCC Protein-L-isoaspartate O-methyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=pcm PE=3 SV=1 2 217 1.0E-17
sp|A0K7U6|PIMT_BURCH Protein-L-isoaspartate O-methyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=pcm PE=3 SV=1 2 217 1.0E-17
sp|Q1BGY4|PIMT_BURCA Protein-L-isoaspartate O-methyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=pcm PE=3 SV=1 2 217 1.0E-17
sp|A1V4L2|PIMT_BURMS Protein-L-isoaspartate O-methyltransferase OS=Burkholderia mallei (strain SAVP1) GN=pcm PE=3 SV=1 5 217 1.0E-17
sp|Q62JV3|PIMT_BURMA Protein-L-isoaspartate O-methyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=pcm PE=3 SV=1 5 217 1.0E-17
sp|A2S291|PIMT_BURM9 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=pcm PE=3 SV=1 5 217 1.0E-17
sp|A3MK86|PIMT_BURM7 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=pcm PE=3 SV=2 5 217 1.0E-17
sp|Q2SWF4|PIMT_BURTA Protein-L-isoaspartate O-methyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pcm PE=3 SV=1 5 217 2.0E-17
sp|A5FEA5|PIMT_FLAJ1 Protein-L-isoaspartate O-methyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=pcm PE=3 SV=1 10 219 2.0E-17
sp|Q214W4|PIMT_RHOPB Protein-L-isoaspartate O-methyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=pcm PE=3 SV=1 15 216 2.0E-17
sp|B1Y0T0|PIMT_LEPCP Protein-L-isoaspartate O-methyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=pcm PE=3 SV=1 10 217 2.0E-17
sp|Q8Y039|PIMT_RALSO Protein-L-isoaspartate O-methyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=pcm PE=3 SV=1 6 217 2.0E-17
sp|B9KQZ1|PIMT_RHOSK Protein-L-isoaspartate O-methyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=pcm PE=3 SV=1 27 219 2.0E-17
sp|Q3J3D1|PIMT_RHOS4 Protein-L-isoaspartate O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=pcm PE=3 SV=1 27 219 2.0E-17
sp|A3PIZ8|PIMT_RHOS1 Protein-L-isoaspartate O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=pcm PE=3 SV=1 27 219 2.0E-17
sp|A0L4K5|PIMT_MAGMM Protein-L-isoaspartate O-methyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=pcm PE=3 SV=1 8 224 3.0E-17
sp|Q5LQ09|PIMT_RUEPO Protein-L-isoaspartate O-methyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pcm PE=3 SV=1 8 219 3.0E-17
sp|A1K4F0|PIMT_AZOSB Protein-L-isoaspartate O-methyltransferase OS=Azoarcus sp. (strain BH72) GN=pcm PE=3 SV=2 6 217 3.0E-17
sp|Q2S176|PIMT_SALRD Protein-L-isoaspartate O-methyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=pcm PE=3 SV=1 8 222 5.0E-17
sp|Q5P833|PIMT_AROAE Protein-L-isoaspartate O-methyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=pcm PE=3 SV=1 4 217 5.0E-17
sp|Q0BEV7|PIMT_BURCM Protein-L-isoaspartate O-methyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=pcm PE=3 SV=1 2 217 5.0E-17
sp|B1YRE4|PIMT_BURA4 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=pcm PE=3 SV=1 2 217 1.0E-16
sp|Q6NCU3|PIMT_RHOPA Protein-L-isoaspartate O-methyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pcm PE=3 SV=2 27 217 1.0E-16
sp|Q12A85|PIMT1_POLSJ Protein-L-isoaspartate O-methyltransferase 1 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pcm1 PE=3 SV=1 27 221 2.0E-16
sp|Q136H9|PIMT_RHOPS Protein-L-isoaspartate O-methyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=pcm PE=3 SV=1 15 216 2.0E-16
sp|Q07N42|PIMT_RHOP5 Protein-L-isoaspartate O-methyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=pcm PE=3 SV=1 15 216 3.0E-16
sp|Q2IWH1|PIMT2_RHOP2 Protein-L-isoaspartate O-methyltransferase 2 OS=Rhodopseudomonas palustris (strain HaA2) GN=pcm2 PE=3 SV=1 15 216 3.0E-16
sp|Q3SRQ7|PIMT_NITWN Protein-L-isoaspartate O-methyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=pcm PE=3 SV=1 15 216 4.0E-16
sp|Q0ANE2|PIMT_MARMM Protein-L-isoaspartate O-methyltransferase OS=Maricaulis maris (strain MCS10) GN=pcm PE=3 SV=1 12 217 5.0E-16
sp|Q9A6T6|PIMT_CAUCR Protein-L-isoaspartate O-methyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pcm PE=3 SV=1 27 217 5.0E-16
sp|B8GX51|PIMT_CAUCN Protein-L-isoaspartate O-methyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=pcm PE=3 SV=1 27 217 5.0E-16
sp|Q46ZH2|PIMT_CUPPJ Protein-L-isoaspartate O-methyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pcm PE=3 SV=1 6 217 1.0E-15
sp|B2JG67|PIMT_BURP8 Protein-L-isoaspartate O-methyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=pcm PE=3 SV=1 5 217 1.0E-15
sp|Q0K951|PIMT2_CUPNH Protein-L-isoaspartate O-methyltransferase 2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pcm2 PE=3 SV=1 23 217 1.0E-15
sp|Q8BHD8|PCMD2_MOUSE Protein-L-isoaspartate O-methyltransferase domain-containing protein 2 OS=Mus musculus GN=Pcmtd2 PE=2 SV=1 6 218 4.0E-15
sp|Q5R7K4|PCMD2_PONAB Protein-L-isoaspartate O-methyltransferase domain-containing protein 2 OS=Pongo abelii GN=PCMTD2 PE=2 SV=1 6 217 4.0E-15
sp|Q9NV79|PCMD2_HUMAN Protein-L-isoaspartate O-methyltransferase domain-containing protein 2 OS=Homo sapiens GN=PCMTD2 PE=2 SV=2 6 217 4.0E-15
sp|Q58CZ2|PCMD2_BOVIN Protein-L-isoaspartate O-methyltransferase domain-containing protein 2 OS=Bos taurus GN=PCMTD2 PE=2 SV=1 6 217 9.0E-15
sp|A8LQK6|PIMT_DINSH Protein-L-isoaspartate O-methyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=pcm PE=3 SV=1 28 219 1.0E-14
sp|P59913|PCMD1_MOUSE Protein-L-isoaspartate O-methyltransferase domain-containing protein 1 OS=Mus musculus GN=Pcmtd1 PE=1 SV=1 6 218 5.0E-14
sp|Q5R7E5|PCMD1_PONAB Protein-L-isoaspartate O-methyltransferase domain-containing protein 1 OS=Pongo abelii GN=PCMTD1 PE=2 SV=1 6 218 6.0E-14
sp|Q96MG8|PCMD1_HUMAN Protein-L-isoaspartate O-methyltransferase domain-containing protein 1 OS=Homo sapiens GN=PCMTD1 PE=1 SV=2 6 218 6.0E-14
sp|A2VDP2|PCMD1_BOVIN Protein-L-isoaspartate O-methyltransferase domain-containing protein 1 OS=Bos taurus GN=PCMTD1 PE=2 SV=1 6 218 6.0E-14
sp|Q56308|PIMT_THEMA Protein-L-isoaspartate O-methyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pcm PE=1 SV=1 17 186 6.0E-14
sp|B5Z887|PIMT_HELPG Protein-L-isoaspartate O-methyltransferase OS=Helicobacter pylori (strain G27) GN=pcm PE=3 SV=1 27 219 5.0E-13
sp|A6SZX9|PIMT_JANMA Protein-L-isoaspartate O-methyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=pcm PE=3 SV=1 13 217 5.0E-13
sp|A4G4J3|PIMT_HERAR Protein-L-isoaspartate O-methyltransferase OS=Herminiimonas arsenicoxydans GN=pcm PE=3 SV=1 13 217 1.0E-12
sp|B6JMT1|PIMT_HELP2 Protein-L-isoaspartate O-methyltransferase OS=Helicobacter pylori (strain P12) GN=pcm PE=3 SV=1 27 219 2.0E-12
sp|O08249|PIMT_RHIME Protein-L-isoaspartate O-methyltransferase OS=Rhizobium meliloti (strain 1021) GN=pcm PE=3 SV=2 78 217 3.0E-12
sp|Q5ZMR3|PCMD1_CHICK Protein-L-isoaspartate O-methyltransferase domain-containing protein 1 OS=Gallus gallus GN=PCMTD1 PE=2 SV=1 6 218 5.0E-12
sp|P56133|PIMT_HELPY Protein-L-isoaspartate O-methyltransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pcm PE=3 SV=1 27 219 5.0E-12
sp|Q9ZKC2|PIMT_HELPJ Protein-L-isoaspartate O-methyltransferase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=pcm PE=3 SV=1 27 219 7.0E-12
sp|Q28TH8|PIMT_JANSC Protein-L-isoaspartate O-methyltransferase OS=Jannaschia sp. (strain CCS1) GN=pcm PE=3 SV=1 12 219 1.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|112460
MAWRCSGKTNSELIVNMAKSGIFKSDRVSKAMTLTDRADFVLHKASAYEDSPQGIGHGVTISAPHMHAYASEYLL
PFLHPGAKVLDVGSGSGYLTAVFHRLVGPTGKVVGIDHIPELVDRSIENLNADGLGEALAKKEIEMVAGDGRKGY
PSSGPYDAIHVGAAAPTLPSELVDQLASPGRMFIPVGTYTQYIEQIDKDENGKITTKKIMGVSYVPLTDRDQQWP
L*
Coding >AgabiH97|112460
ATGGCCTGGCGTTGCTCAGGAAAGACCAACTCCGAGCTTATTGTCAACATGGCTAAGAGCGGAATATTCAAGTCC
GACCGGGTATCCAAGGCGATGACGCTTACGGATCGAGCCGACTTCGTTTTGCACAAGGCTAGTGCCTATGAGGAT
TCTCCTCAGGGAATCGGGCATGGCGTCACCATCAGCGCACCACACATGCATGCCTATGCTTCAGAATATTTACTC
CCTTTTCTCCATCCAGGAGCCAAAGTTCTCGATGTGGGAAGTGGATCAGGTTATCTAACGGCCGTTTTCCACCGG
CTTGTTGGTCCTACAGGCAAGGTAGTTGGGATAGACCATATTCCTGAGCTAGTCGATCGGTCTATAGAGAACCTG
AATGCAGACGGGCTTGGCGAGGCACTTGCAAAGAAGGAAATTGAAATGGTGGCAGGGGATGGAAGAAAAGGGTAT
CCAAGCAGTGGTCCTTATGACGCAATACACGTCGGTGCTGCTGCCCCCACTTTGCCTTCTGAACTCGTCGACCAG
CTTGCCTCTCCTGGCCGTATGTTTATCCCCGTTGGGACTTATACGCAATACATCGAACAAATCGACAAGGACGAG
AATGGTAAAATTACTACTAAGAAGATTATGGGCGTCTCCTATGTTCCATTGACGGACAGGGATCAACAGTGGCCC
TTGTAA
Transcript >AgabiH97|112460
ATGGCCTGGCGTTGCTCAGGAAAGACCAACTCCGAGCTTATTGTCAACATGGCTAAGAGCGGAATATTCAAGTCC
GACCGGGTATCCAAGGCGATGACGCTTACGGATCGAGCCGACTTCGTTTTGCACAAGGCTAGTGCCTATGAGGAT
TCTCCTCAGGGAATCGGGCATGGCGTCACCATCAGCGCACCACACATGCATGCCTATGCTTCAGAATATTTACTC
CCTTTTCTCCATCCAGGAGCCAAAGTTCTCGATGTGGGAAGTGGATCAGGTTATCTAACGGCCGTTTTCCACCGG
CTTGTTGGTCCTACAGGCAAGGTAGTTGGGATAGACCATATTCCTGAGCTAGTCGATCGGTCTATAGAGAACCTG
AATGCAGACGGGCTTGGCGAGGCACTTGCAAAGAAGGAAATTGAAATGGTGGCAGGGGATGGAAGAAAAGGGTAT
CCAAGCAGTGGTCCTTATGACGCAATACACGTCGGTGCTGCTGCCCCCACTTTGCCTTCTGAACTCGTCGACCAG
CTTGCCTCTCCTGGCCGTATGTTTATCCCCGTTGGGACTTATACGCAATACATCGAACAAATCGACAAGGACGAG
AATGGTAAAATTACTACTAAGAAGATTATGGGCGTCTCCTATGTTCCATTGACGGACAGGGATCAACAGTGGCCC
TTGTAA
Gene >AgabiH97|112460
ATGGCCTGGCGTTGCTCAGGAAAGACCAACTCCGAGCTTATTGTCAACATGGCTAAGAGCGGAATATTCAAGTCC
GACCGGGTATCCAAGGTAGAGTCCTTATCGTCGCCGTATTCTTCGGGGCCCTTATTCACGGATATTGATTTTGAA
GGCGATGACGCTTACGGATCGAGCCGACTTCGTTTTGCACAAGGCTAGTGCCTATGAGGATTCTCCTCAGTTGCG
TCTGTTTTAGATTCTCAGCATGGCTTGGCTCACCAGCGACGCTGGTAGGGGAATCGGGCATGGCGTCACCATCAG
CGCACCACACATGGTCAGAACACGCACTGGTTACTGCTCCGCGGAGTCAACTGACGTATTTACCCCCCAGCATGC
CTATGCTTCAGAATATTTACTCCCTTTTCTCCATCCAGGAGCCAAAGTTCTCGATGTGGGAAGTGGATCAGGTTA
TCTAACGGCCGTTTTCCACCGGCTTGTTGGTCCTACAGGCAAGGTAGTTGGGATAGACCATATTCCTGAGCTAGT
CGATCGGTCTATAGAGAACCTGAATGCAGACGGGCTTGGCGAGGCACTTGCAAAGAAGGAAATTGAAATGGTGGC
AGGGGATGGAAGAAAAGGGTATCCAAGCAGTGGTTCGCAGTAGACAATTACTTCCGCACGTCTTGGCACTTCACG
CTGATCTTGATGACAGGTCCTTATGACGCAATACACGTCGGTGCTGCTGCCCCCACTTTGCCTTCTGAACTCGTC
GACCAGCTTGCCTCTCCTGGCCGTATGTTTATCCCCGTTGGGACTTATACGCAATACATCGAACAAATCGACAAG
GACGAGAATGGTAAAATTACTACTAAGAAGATTATGGGCGTCTCCGTGAGTATGAAAACAACCTTTATGAAAGAC
GCTCAAAAATTAATCTTATGAGCACAGTATGTTCCATTGACGGACAGGGATCAACAGTGGCCCTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail