Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|112440
Gene name
Locationscaffold_8:1665527..1666334
Strand+
Gene length (bp)807
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 344.24 166.88 521.61
Initials Initials knots 572.58 332.16 812.99
Pileal_Stipeal_center Stage I stipe center 253.24 151.00 355.49
Pileal_Stipeal_shell Stage I stipe shell 87.93 48.84 127.01
DIF_stipe_center Stage II stipe center 443.96 263.41 624.50
DIF_stipe_shell Stage II stipe shell 381.62 227.74 535.50
DIF_stipe_skin Stage II stipe skin 258.17 157.79 358.54
DIF_cap_skin Stage II cap skin 51.26 28.86 73.66
DIF_cap_tissue Stage II cap tissue 97.90 58.82 136.97
DIF_gill_tissue Stage II gill tissue 149.21 90.54 207.87
YFB_stipe_center Young fruiting body stipe center 596.20 289.92 902.48
YFB_stipe_shell Young fruiting body stipe shell 758.39 408.26 1108.53
YFB_stipe_skin Young fruiting body stipe skin 422.72 250.70 594.75
YFB_cap_skin Young fruiting body cap skin 48.37 26.86 69.88
YFB_cap_tissue Young fruiting body cap tissue 267.41 164.04 370.77
YFB_gill_tissue Young fruiting body gill tissue 87.37 51.90 122.84
YFB_veil Young fruiting body veil 107.24 64.36 150.11

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.004928 yes
Casing YFB_stipe_center 0.114735 no
Casing YFB_stipe_shell 0.008791 yes
Casing YFB_stipe_skin 0.629826 no
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.524637 no
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.115964 no
Casing Pileal_Stipeal_center 0.397993 no
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.531725 no
Casing DIF_stipe_shell 0.848694 no
Casing DIF_stipe_skin 0.440852 no
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.030372 yes
DIF_gill_tissue YFB_gill_tissue 0.051520 no
DIF_gill_tissue YFB_veil 0.318419 no
YFB_stipe_center YFB_stipe_shell 0.585974 no
YFB_stipe_center YFB_stipe_skin 0.340284 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.008121 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.045487 yes
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.114583 no
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.000613 yes
YFB_cap_skin YFB_gill_tissue 0.038278 yes
YFB_cap_skin YFB_veil 0.004928 yes
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.612049 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.948695 no
Initials YFB_stipe_shell 0.456197 no
Initials YFB_stipe_skin 0.361281 no
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.003765 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.002084 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.488978 no
Initials DIF_stipe_shell 0.187178 no
Initials DIF_stipe_skin 0.002525 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.049674 yes
Pileal_Stipeal_center YFB_stipe_center 0.004928 yes
Pileal_Stipeal_center YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_center YFB_stipe_skin 0.059906 no
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.916992 no
Pileal_Stipeal_center YFB_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_veil 0.001140 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_center 0.037364 yes
Pileal_Stipeal_center DIF_stipe_shell 0.160907 no
Pileal_Stipeal_center DIF_stipe_skin 0.971706 no
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.066207 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.045911 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.991186 no
Pileal_Stipeal_shell YFB_veil 0.638830 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.071782 no
Pileal_Stipeal_shell DIF_cap_tissue 0.823506 no
DIF_stipe_center DIF_gill_tissue 0.000613 yes
DIF_stipe_center YFB_stipe_center 0.441072 no
DIF_stipe_center YFB_stipe_shell 0.075382 no
DIF_stipe_center YFB_stipe_skin 0.928255 no
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.067147 no
DIF_stipe_center YFB_gill_tissue 0.000613 yes
DIF_stipe_center YFB_veil 0.000613 yes
DIF_stipe_center DIF_stipe_shell 0.725012 no
DIF_stipe_center DIF_stipe_skin 0.043983 yes
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.179455 no
DIF_stipe_shell YFB_stipe_shell 0.016669 yes
DIF_stipe_shell YFB_stipe_skin 0.827452 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.252194 no
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.000613 yes
DIF_stipe_shell DIF_stipe_skin 0.184076 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.041603 yes
DIF_stipe_skin YFB_stipe_center 0.006387 yes
DIF_stipe_skin YFB_stipe_shell 0.000613 yes
DIF_stipe_skin YFB_stipe_skin 0.074661 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.949840 no
DIF_stipe_skin YFB_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_veil 0.001140 yes
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.000613 yes
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.923528 no
DIF_cap_skin YFB_cap_tissue 0.000613 yes
DIF_cap_skin YFB_gill_tissue 0.067896 no
DIF_cap_skin YFB_veil 0.007439 yes
DIF_cap_skin DIF_cap_tissue 0.020523 yes
DIF_cap_tissue DIF_gill_tissue 0.155976 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.010412 yes
DIF_cap_tissue YFB_cap_tissue 0.000613 yes
DIF_cap_tissue YFB_gill_tissue 0.809118 no
DIF_cap_tissue YFB_veil 0.860516 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|112440
MALSLPPELWLLVFLHLDSLSLAACACLSSRFLPLAHARLFAHVSLLPRRRPPATALTSVFPDACTKLLHLLSTS
PSLAHHIKRLSIIDGTLFPSLARRDQLNGAPWFLKTSPHVLHTLFQKLNIHSLDLVFPDGPKVSWNLIPQDIRRS
LLASSPHLHSLSLHNLSFDTPSTLISTLSHSSITHLTLHNIKLYPDLLTDYCPEKNQTWSRHAKSFPHDPPQSLS
LTHTLEMLCISSDPLHQDPDTLHLLSSLFAHSSTRTVIRSEFA*
Coding >AgabiH97|112440
ATGGCTCTTTCTCTTCCCCCAGAGCTCTGGCTCCTCGTTTTCTTGCATCTAGACTCGCTCTCGCTCGCTGCCTGT
GCCTGTCTCTCCTCCCGCTTTCTCCCCCTCGCACACGCCCGTCTCTTTGCCCATGTCTCCCTCCTCCCTCGCCGC
CGTCCTCCCGCGACAGCTCTCACCTCTGTCTTCCCAGATGCTTGCACCAAACTCCTCCATCTCTTGTCCACGTCC
CCCTCACTTGCCCACCATATTAAACGTCTCTCCATCATCGATGGAACTCTCTTTCCCTCCCTCGCAAGGCGAGAC
CAACTCAACGGTGCACCCTGGTTTCTCAAAACGTCTCCTCACGTTCTACATACTCTCTTTCAAAAACTAAATATC
CACTCTCTCGACCTCGTCTTTCCAGACGGTCCAAAAGTCTCTTGGAACCTCATCCCTCAAGACATCCGCCGTTCT
CTCTTGGCATCCTCACCTCACCTCCATTCCCTCTCTCTCCATAACCTTTCATTCGACACACCCTCAACCCTCATT
TCCACACTCTCTCACAGCTCCATAACTCATCTCACTCTCCATAACATCAAACTCTATCCGGATCTACTCACTGAC
TACTGCCCAGAAAAGAACCAGACGTGGTCTCGGCATGCCAAGTCTTTCCCTCATGACCCACCTCAATCACTCTCT
TTAACTCATACTTTGGAAATGCTTTGTATAAGCTCTGATCCTTTGCACCAAGATCCGGACACGCTTCACCTCCTG
AGCTCTTTATTCGCTCATTCCTCTACTCGAACGGTCATCCGTTCCGAATTTGCATAA
Transcript >AgabiH97|112440
ATGGCTCTTTCTCTTCCCCCAGAGCTCTGGCTCCTCGTTTTCTTGCATCTAGACTCGCTCTCGCTCGCTGCCTGT
GCCTGTCTCTCCTCCCGCTTTCTCCCCCTCGCACACGCCCGTCTCTTTGCCCATGTCTCCCTCCTCCCTCGCCGC
CGTCCTCCCGCGACAGCTCTCACCTCTGTCTTCCCAGATGCTTGCACCAAACTCCTCCATCTCTTGTCCACGTCC
CCCTCACTTGCCCACCATATTAAACGTCTCTCCATCATCGATGGAACTCTCTTTCCCTCCCTCGCAAGGCGAGAC
CAACTCAACGGTGCACCCTGGTTTCTCAAAACGTCTCCTCACGTTCTACATACTCTCTTTCAAAAACTAAATATC
CACTCTCTCGACCTCGTCTTTCCAGACGGTCCAAAAGTCTCTTGGAACCTCATCCCTCAAGACATCCGCCGTTCT
CTCTTGGCATCCTCACCTCACCTCCATTCCCTCTCTCTCCATAACCTTTCATTCGACACACCCTCAACCCTCATT
TCCACACTCTCTCACAGCTCCATAACTCATCTCACTCTCCATAACATCAAACTCTATCCGGATCTACTCACTGAC
TACTGCCCAGAAAAGAACCAGACGTGGTCTCGGCATGCCAAGTCTTTCCCTCATGACCCACCTCAATCACTCTCT
TTAACTCATACTTTGGAAATGCTTTGTATAAGCTCTGATCCTTTGCACCAAGATCCGGACACGCTTCACCTCCTG
AGCTCTTTATTCGCTCATTCCTCTACTCGAACGGTCATCCGTTCCGAATTTGCATAA
Gene >AgabiH97|112440
ATGGCTCTTTCTCTTCCCCCAGAGCTCTGGCTCCTCGTTTTCTTGCATCTAGACTCGCTCTCGCTCGCTGCCTGT
GCCTGTCTCTCCTCCCGCTTTCTCCCCCTCGCACACGCCCGTCTCTTTGCCCATGTCTCCCTCCTCCCTCGCCGC
CGTCCTCCCGCGACAGCTCTCACCTCTGTCTTCCCAGATGCTTGCACCAAACTCCTCCATCTCTTGTCCACGTCC
CCCTCACTTGCCCACCATATTAAACGTCTCTCCATCATCGATGGAACTCTCTTTCCCTCCCTCGCAAGGCGAGAC
CAACTCAACGGTGCACCCTGGTTTCTCAAAACGTCTCCTCACGTTCTACATACTCTCTTTCAAAAACTAAATATC
CACTCTCTCGACCTCGTCTTTCCAGACGGTCCAAAAGTCTCTTGGAACCTCATCCCTCAAGACATCCGCCGTTCT
CTCTTGGCATCCTCACCTCACCTCCATTCCCTCTCTCTCCATAACCTTTCATTCGACACACCCTCAACCCTCATT
TCCACACTCTCTCACAGCTCCATAACTCATCTCACTCTCCATAACATCAAACTCTATCCGGATCTACTCACTGAC
TACTGCCCAGAAAAGAACCAGACGTGGTCTCGGCATGCCAAGTCTTTCCCTCATGACCCACCTCAATCACTCTCT
TTAACTCATACTTTGGAAATGCTTTGTATAAGCTCTGATCCTTTGCACCAAGATCCGGACACGCTTCACCTCCTG
AGCTCTTTATTCGCTCATTCCTCTACTCGAACGGTCATCCGTTCCGAATTTGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail