© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|112440 |
| Gene name | |
| Location | scaffold_8:1665527..1666334 |
| Strand | + |
| Gene length (bp) | 807 |
| Transcript length (bp) | 807 |
| Coding sequence length (bp) | 807 |
| Protein length (aa) | 269 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 24 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 344.24 | 166.88 | 521.61 |
| Initials | Initials knots | 572.58 | 332.16 | 812.99 |
| Pileal_Stipeal_center | Stage I stipe center | 253.24 | 151.00 | 355.49 |
| Pileal_Stipeal_shell | Stage I stipe shell | 87.93 | 48.84 | 127.01 |
| DIF_stipe_center | Stage II stipe center | 443.96 | 263.41 | 624.50 |
| DIF_stipe_shell | Stage II stipe shell | 381.62 | 227.74 | 535.50 |
| DIF_stipe_skin | Stage II stipe skin | 258.17 | 157.79 | 358.54 |
| DIF_cap_skin | Stage II cap skin | 51.26 | 28.86 | 73.66 |
| DIF_cap_tissue | Stage II cap tissue | 97.90 | 58.82 | 136.97 |
| DIF_gill_tissue | Stage II gill tissue | 149.21 | 90.54 | 207.87 |
| YFB_stipe_center | Young fruiting body stipe center | 596.20 | 289.92 | 902.48 |
| YFB_stipe_shell | Young fruiting body stipe shell | 758.39 | 408.26 | 1108.53 |
| YFB_stipe_skin | Young fruiting body stipe skin | 422.72 | 250.70 | 594.75 |
| YFB_cap_skin | Young fruiting body cap skin | 48.37 | 26.86 | 69.88 |
| YFB_cap_tissue | Young fruiting body cap tissue | 267.41 | 164.04 | 370.77 |
| YFB_gill_tissue | Young fruiting body gill tissue | 87.37 | 51.90 | 122.84 |
| YFB_veil | Young fruiting body veil | 107.24 | 64.36 | 150.11 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.004928 | yes |
| Casing | YFB_stipe_center | 0.114735 | no |
| Casing | YFB_stipe_shell | 0.008791 | yes |
| Casing | YFB_stipe_skin | 0.629826 | no |
| Casing | YFB_cap_skin | 0.000613 | yes |
| Casing | YFB_cap_tissue | 0.524637 | no |
| Casing | YFB_gill_tissue | 0.000613 | yes |
| Casing | YFB_veil | 0.000613 | yes |
| Casing | Initials | 0.115964 | no |
| Casing | Pileal_Stipeal_center | 0.397993 | no |
| Casing | Pileal_Stipeal_shell | 0.000613 | yes |
| Casing | DIF_stipe_center | 0.531725 | no |
| Casing | DIF_stipe_shell | 0.848694 | no |
| Casing | DIF_stipe_skin | 0.440852 | no |
| Casing | DIF_cap_skin | 0.000613 | yes |
| Casing | DIF_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_tissue | 0.030372 | yes |
| DIF_gill_tissue | YFB_gill_tissue | 0.051520 | no |
| DIF_gill_tissue | YFB_veil | 0.318419 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.585974 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.340284 | no |
| YFB_stipe_center | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_center | YFB_cap_tissue | 0.008121 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_veil | 0.000613 | yes |
| YFB_stipe_shell | YFB_stipe_skin | 0.045487 | yes |
| YFB_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_veil | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_tissue | 0.114583 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_skin | YFB_veil | 0.000613 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.000613 | yes |
| YFB_cap_skin | YFB_gill_tissue | 0.038278 | yes |
| YFB_cap_skin | YFB_veil | 0.004928 | yes |
| YFB_cap_tissue | YFB_gill_tissue | 0.000613 | yes |
| YFB_cap_tissue | YFB_veil | 0.000613 | yes |
| YFB_gill_tissue | YFB_veil | 0.612049 | no |
| Initials | DIF_gill_tissue | 0.000613 | yes |
| Initials | YFB_stipe_center | 0.948695 | no |
| Initials | YFB_stipe_shell | 0.456197 | no |
| Initials | YFB_stipe_skin | 0.361281 | no |
| Initials | YFB_cap_skin | 0.000613 | yes |
| Initials | YFB_cap_tissue | 0.003765 | yes |
| Initials | YFB_gill_tissue | 0.000613 | yes |
| Initials | YFB_veil | 0.000613 | yes |
| Initials | Pileal_Stipeal_center | 0.002084 | yes |
| Initials | Pileal_Stipeal_shell | 0.000613 | yes |
| Initials | DIF_stipe_center | 0.488978 | no |
| Initials | DIF_stipe_shell | 0.187178 | no |
| Initials | DIF_stipe_skin | 0.002525 | yes |
| Initials | DIF_cap_skin | 0.000613 | yes |
| Initials | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.049674 | yes |
| Pileal_Stipeal_center | YFB_stipe_center | 0.004928 | yes |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.059906 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.916992 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_veil | 0.001140 | yes |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_stipe_center | 0.037364 | yes |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.160907 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.971706 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.066207 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.045911 | yes |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.991186 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.638830 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.071782 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.823506 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_center | YFB_stipe_center | 0.441072 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.075382 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.928255 | no |
| DIF_stipe_center | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.067147 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.000613 | yes |
| DIF_stipe_center | YFB_veil | 0.000613 | yes |
| DIF_stipe_center | DIF_stipe_shell | 0.725012 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.043983 | yes |
| DIF_stipe_center | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_center | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_stipe_center | 0.179455 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.016669 | yes |
| DIF_stipe_shell | YFB_stipe_skin | 0.827452 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.252194 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_veil | 0.000613 | yes |
| DIF_stipe_shell | DIF_stipe_skin | 0.184076 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.041603 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.006387 | yes |
| DIF_stipe_skin | YFB_stipe_shell | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_skin | 0.074661 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | YFB_cap_tissue | 0.949840 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_veil | 0.001140 | yes |
| DIF_stipe_skin | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | DIF_cap_tissue | 0.000613 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.923528 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.000613 | yes |
| DIF_cap_skin | YFB_gill_tissue | 0.067896 | no |
| DIF_cap_skin | YFB_veil | 0.007439 | yes |
| DIF_cap_skin | DIF_cap_tissue | 0.020523 | yes |
| DIF_cap_tissue | DIF_gill_tissue | 0.155976 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.010412 | yes |
| DIF_cap_tissue | YFB_cap_tissue | 0.000613 | yes |
| DIF_cap_tissue | YFB_gill_tissue | 0.809118 | no |
| DIF_cap_tissue | YFB_veil | 0.860516 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|112440 MALSLPPELWLLVFLHLDSLSLAACACLSSRFLPLAHARLFAHVSLLPRRRPPATALTSVFPDACTKLLHLLSTS PSLAHHIKRLSIIDGTLFPSLARRDQLNGAPWFLKTSPHVLHTLFQKLNIHSLDLVFPDGPKVSWNLIPQDIRRS LLASSPHLHSLSLHNLSFDTPSTLISTLSHSSITHLTLHNIKLYPDLLTDYCPEKNQTWSRHAKSFPHDPPQSLS LTHTLEMLCISSDPLHQDPDTLHLLSSLFAHSSTRTVIRSEFA* |
| Coding | >AgabiH97|112440 ATGGCTCTTTCTCTTCCCCCAGAGCTCTGGCTCCTCGTTTTCTTGCATCTAGACTCGCTCTCGCTCGCTGCCTGT GCCTGTCTCTCCTCCCGCTTTCTCCCCCTCGCACACGCCCGTCTCTTTGCCCATGTCTCCCTCCTCCCTCGCCGC CGTCCTCCCGCGACAGCTCTCACCTCTGTCTTCCCAGATGCTTGCACCAAACTCCTCCATCTCTTGTCCACGTCC CCCTCACTTGCCCACCATATTAAACGTCTCTCCATCATCGATGGAACTCTCTTTCCCTCCCTCGCAAGGCGAGAC CAACTCAACGGTGCACCCTGGTTTCTCAAAACGTCTCCTCACGTTCTACATACTCTCTTTCAAAAACTAAATATC CACTCTCTCGACCTCGTCTTTCCAGACGGTCCAAAAGTCTCTTGGAACCTCATCCCTCAAGACATCCGCCGTTCT CTCTTGGCATCCTCACCTCACCTCCATTCCCTCTCTCTCCATAACCTTTCATTCGACACACCCTCAACCCTCATT TCCACACTCTCTCACAGCTCCATAACTCATCTCACTCTCCATAACATCAAACTCTATCCGGATCTACTCACTGAC TACTGCCCAGAAAAGAACCAGACGTGGTCTCGGCATGCCAAGTCTTTCCCTCATGACCCACCTCAATCACTCTCT TTAACTCATACTTTGGAAATGCTTTGTATAAGCTCTGATCCTTTGCACCAAGATCCGGACACGCTTCACCTCCTG AGCTCTTTATTCGCTCATTCCTCTACTCGAACGGTCATCCGTTCCGAATTTGCATAA |
| Transcript | >AgabiH97|112440 ATGGCTCTTTCTCTTCCCCCAGAGCTCTGGCTCCTCGTTTTCTTGCATCTAGACTCGCTCTCGCTCGCTGCCTGT GCCTGTCTCTCCTCCCGCTTTCTCCCCCTCGCACACGCCCGTCTCTTTGCCCATGTCTCCCTCCTCCCTCGCCGC CGTCCTCCCGCGACAGCTCTCACCTCTGTCTTCCCAGATGCTTGCACCAAACTCCTCCATCTCTTGTCCACGTCC CCCTCACTTGCCCACCATATTAAACGTCTCTCCATCATCGATGGAACTCTCTTTCCCTCCCTCGCAAGGCGAGAC CAACTCAACGGTGCACCCTGGTTTCTCAAAACGTCTCCTCACGTTCTACATACTCTCTTTCAAAAACTAAATATC CACTCTCTCGACCTCGTCTTTCCAGACGGTCCAAAAGTCTCTTGGAACCTCATCCCTCAAGACATCCGCCGTTCT CTCTTGGCATCCTCACCTCACCTCCATTCCCTCTCTCTCCATAACCTTTCATTCGACACACCCTCAACCCTCATT TCCACACTCTCTCACAGCTCCATAACTCATCTCACTCTCCATAACATCAAACTCTATCCGGATCTACTCACTGAC TACTGCCCAGAAAAGAACCAGACGTGGTCTCGGCATGCCAAGTCTTTCCCTCATGACCCACCTCAATCACTCTCT TTAACTCATACTTTGGAAATGCTTTGTATAAGCTCTGATCCTTTGCACCAAGATCCGGACACGCTTCACCTCCTG AGCTCTTTATTCGCTCATTCCTCTACTCGAACGGTCATCCGTTCCGAATTTGCATAA |
| Gene | >AgabiH97|112440 ATGGCTCTTTCTCTTCCCCCAGAGCTCTGGCTCCTCGTTTTCTTGCATCTAGACTCGCTCTCGCTCGCTGCCTGT GCCTGTCTCTCCTCCCGCTTTCTCCCCCTCGCACACGCCCGTCTCTTTGCCCATGTCTCCCTCCTCCCTCGCCGC CGTCCTCCCGCGACAGCTCTCACCTCTGTCTTCCCAGATGCTTGCACCAAACTCCTCCATCTCTTGTCCACGTCC CCCTCACTTGCCCACCATATTAAACGTCTCTCCATCATCGATGGAACTCTCTTTCCCTCCCTCGCAAGGCGAGAC CAACTCAACGGTGCACCCTGGTTTCTCAAAACGTCTCCTCACGTTCTACATACTCTCTTTCAAAAACTAAATATC CACTCTCTCGACCTCGTCTTTCCAGACGGTCCAAAAGTCTCTTGGAACCTCATCCCTCAAGACATCCGCCGTTCT CTCTTGGCATCCTCACCTCACCTCCATTCCCTCTCTCTCCATAACCTTTCATTCGACACACCCTCAACCCTCATT TCCACACTCTCTCACAGCTCCATAACTCATCTCACTCTCCATAACATCAAACTCTATCCGGATCTACTCACTGAC TACTGCCCAGAAAAGAACCAGACGTGGTCTCGGCATGCCAAGTCTTTCCCTCATGACCCACCTCAATCACTCTCT TTAACTCATACTTTGGAAATGCTTTGTATAAGCTCTGATCCTTTGCACCAAGATCCGGACACGCTTCACCTCCTG AGCTCTTTATTCGCTCATTCCTCTACTCGAACGGTCATCCGTTCCGAATTTGCATAA |