© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|112390 |
| Gene name | |
| Location | scaffold_8:1650030..1650843 |
| Strand | + |
| Gene length (bp) | 813 |
| Transcript length (bp) | 693 |
| Coding sequence length (bp) | 693 |
| Protein length (aa) | 231 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF01083 | Cutinase | Cutinase | 1.1E-48 | 20 | 224 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O59893|AXE2_TALPU | Acetylxylan esterase 2 OS=Talaromyces purpurogenus GN=axe-2 PE=1 SV=1 | 7 | 225 | 2.0E-92 |
| sp|Q99034|AXE1_HYPJE | Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 | 13 | 225 | 2.0E-83 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0016787 | hydrolase activity | Yes |
| GO:0003824 | catalytic activity | No |
| GO:0003674 | molecular_function | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 20 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 7.02 | 2.77 | 11.27 |
| Initials | Initials knots | 3.49 | 1.11 | 5.87 |
| Pileal_Stipeal_center | Stage I stipe center | 8.77 | 3.70 | 13.84 |
| Pileal_Stipeal_shell | Stage I stipe shell | 8.60 | 3.61 | 13.59 |
| DIF_stipe_center | Stage II stipe center | 17.15 | 8.05 | 26.25 |
| DIF_stipe_shell | Stage II stipe shell | 7.34 | 2.95 | 11.72 |
| DIF_stipe_skin | Stage II stipe skin | 6.69 | 2.65 | 10.72 |
| DIF_cap_skin | Stage II cap skin | 8.30 | 3.45 | 13.16 |
| DIF_cap_tissue | Stage II cap tissue | 8.19 | 3.38 | 12.99 |
| DIF_gill_tissue | Stage II gill tissue | 10.89 | 4.72 | 17.06 |
| YFB_stipe_center | Young fruiting body stipe center | 13.73 | 6.24 | 21.23 |
| YFB_stipe_shell | Young fruiting body stipe shell | 12.00 | 5.25 | 18.75 |
| YFB_stipe_skin | Young fruiting body stipe skin | 8.14 | 3.38 | 12.89 |
| YFB_cap_skin | Young fruiting body cap skin | 9.63 | 4.10 | 15.16 |
| YFB_cap_tissue | Young fruiting body cap tissue | 13.09 | 5.89 | 20.29 |
| YFB_gill_tissue | Young fruiting body gill tissue | 10.02 | 4.31 | 15.74 |
| YFB_veil | Young fruiting body veil | 9.13 | 3.88 | 14.38 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.347828 | no |
| Casing | YFB_stipe_center | 0.087080 | no |
| Casing | YFB_stipe_shell | 0.218974 | no |
| Casing | YFB_stipe_skin | 0.825118 | no |
| Casing | YFB_cap_skin | 0.548548 | no |
| Casing | YFB_cap_tissue | 0.126175 | no |
| Casing | YFB_gill_tissue | 0.480401 | no |
| Casing | YFB_veil | 0.636908 | no |
| Casing | Initials | 0.125287 | no |
| Casing | Pileal_Stipeal_center | 0.709651 | no |
| Casing | Pileal_Stipeal_shell | 0.739963 | no |
| Casing | DIF_stipe_center | 0.013186 | yes |
| Casing | DIF_stipe_shell | 0.958944 | no |
| Casing | DIF_stipe_skin | 0.953994 | no |
| Casing | DIF_cap_skin | 0.799496 | no |
| Casing | DIF_cap_tissue | 0.815411 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.673977 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.888534 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.577040 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.858718 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.756372 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.908823 | no |
| DIF_gill_tissue | YFB_veil | 0.774288 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.835884 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.202921 | no |
| YFB_stipe_center | YFB_cap_skin | 0.458243 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.948717 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.526760 | no |
| YFB_stipe_center | YFB_veil | 0.360096 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.408056 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.704658 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.904845 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.770298 | no |
| YFB_stipe_shell | YFB_veil | 0.607221 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.790635 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.271949 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.724325 | no |
| YFB_stipe_skin | YFB_veil | 0.866393 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.548385 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.959070 | no |
| YFB_cap_skin | YFB_veil | 0.943940 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.611568 | no |
| YFB_cap_tissue | YFB_veil | 0.443232 | no |
| YFB_gill_tissue | YFB_veil | 0.896088 | no |
| Initials | DIF_gill_tissue | 0.006742 | yes |
| Initials | YFB_stipe_center | 0.001140 | yes |
| Initials | YFB_stipe_shell | 0.002951 | yes |
| Initials | YFB_stipe_skin | 0.052346 | no |
| Initials | YFB_cap_skin | 0.019442 | yes |
| Initials | YFB_cap_tissue | 0.002084 | yes |
| Initials | YFB_gill_tissue | 0.012880 | yes |
| Initials | YFB_veil | 0.026461 | yes |
| Initials | Pileal_Stipeal_center | 0.033906 | yes |
| Initials | Pileal_Stipeal_shell | 0.039390 | yes |
| Initials | DIF_stipe_center | 0.000613 | yes |
| Initials | DIF_stipe_shell | 0.098771 | no |
| Initials | DIF_stipe_skin | 0.158500 | no |
| Initials | DIF_cap_skin | 0.046952 | yes |
| Initials | DIF_cap_tissue | 0.049674 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.712799 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.301751 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.543768 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.918644 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.900900 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.383798 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.843285 | no |
| Pileal_Stipeal_center | YFB_veil | 0.959321 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.979912 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.071041 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.781654 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.630273 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.944499 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.925532 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.675756 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.274660 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.503200 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.941994 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.871867 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.353104 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.810898 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.936813 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.062229 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.807483 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.658595 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.965183 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.948117 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.275156 | no |
| DIF_stipe_center | YFB_stipe_center | 0.665704 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.429603 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.037140 | yes |
| DIF_stipe_center | YFB_cap_skin | 0.136034 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.580073 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.175019 | no |
| DIF_stipe_center | YFB_veil | 0.097608 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.020790 | yes |
| DIF_stipe_center | DIF_stipe_skin | 0.010728 | yes |
| DIF_stipe_center | DIF_cap_skin | 0.044631 | yes |
| DIF_stipe_center | DIF_cap_tissue | 0.040058 | yes |
| DIF_stipe_shell | DIF_gill_tissue | 0.416123 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.123655 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.272636 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.882516 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.628392 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.168680 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.555552 | no |
| DIF_stipe_shell | YFB_veil | 0.711451 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.901200 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.859011 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.874271 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.280957 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.067706 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.168544 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.750379 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.474406 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.094162 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.404591 | no |
| DIF_stipe_skin | YFB_veil | 0.559424 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.725231 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.741726 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.615797 | no |
| DIF_cap_skin | YFB_stipe_center | 0.231862 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.446701 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.979095 | no |
| DIF_cap_skin | YFB_cap_skin | 0.822248 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.298702 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.756372 | no |
| DIF_cap_skin | YFB_veil | 0.894638 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.985066 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.588916 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.211921 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.422433 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.991849 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.800369 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.275539 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.734225 | no |
| DIF_cap_tissue | YFB_veil | 0.874431 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|112390 MSPIRFASLFLLGATLAAAQCPQVHIFGARETTVPPGYGTAGPVVNSIISAFPGATAEPINYPACGGQASCGGVS YASSVVQGVAAVARQVNSFNQQCPNAVLVLVGYSQGGQLFDDAYCGGGDSNEGISDPSIPISTAAQAKIAAAIFM GDPRHIPGLSYNVGTCQASGFAPRPNGFQCPHASNIQSYCDAADPFCCNGNDQNTHQGYAVEYGSAALNFVRGKV NAMLG* |
| Coding | >AgabiH97|112390 ATGTCACCCATCCGCTTTGCATCTCTCTTCCTTCTAGGAGCCACTCTCGCTGCTGCCCAGTGTCCACAAGTTCAC ATCTTTGGCGCGCGTGAGACTACTGTTCCTCCCGGCTATGGCACAGCAGGTCCGGTCGTCAACTCCATCATTTCT GCATTCCCAGGAGCCACCGCTGAACCTATTAATTATCCTGCTTGCGGTGGTCAAGCTTCGTGTGGTGGTGTCAGT TATGCCTCCTCCGTTGTTCAAGGTGTAGCTGCTGTAGCTCGCCAAGTGAATTCTTTCAACCAGCAATGCCCCAAT GCAGTCTTGGTCTTGGTTGGTTACTCACAGGGCGGTCAACTTTTTGATGATGCCTATTGCGGTGGAGGTGACAGT AATGAAGGCATCAGCGATCCTTCGATTCCCATTTCTACAGCTGCTCAGGCCAAAATTGCTGCAGCCATCTTCATG GGCGACCCGCGTCACATCCCTGGTTTGTCCTACAATGTCGGAACCTGCCAAGCGAGTGGCTTCGCTCCTCGACCC AATGGCTTCCAGTGCCCACACGCGAGTAACATTCAATCTTACTGCGACGCTGCAGACCCATTCTGCTGCAACGGA AACGACCAGAACACTCACCAGGGCTACGCTGTTGAGTATGGCTCTGCCGCCCTCAACTTTGTCCGGGGCAAAGTC AATGCCATGCTCGGTTAA |
| Transcript | >AgabiH97|112390 ATGTCACCCATCCGCTTTGCATCTCTCTTCCTTCTAGGAGCCACTCTCGCTGCTGCCCAGTGTCCACAAGTTCAC ATCTTTGGCGCGCGTGAGACTACTGTTCCTCCCGGCTATGGCACAGCAGGTCCGGTCGTCAACTCCATCATTTCT GCATTCCCAGGAGCCACCGCTGAACCTATTAATTATCCTGCTTGCGGTGGTCAAGCTTCGTGTGGTGGTGTCAGT TATGCCTCCTCCGTTGTTCAAGGTGTAGCTGCTGTAGCTCGCCAAGTGAATTCTTTCAACCAGCAATGCCCCAAT GCAGTCTTGGTCTTGGTTGGTTACTCACAGGGCGGTCAACTTTTTGATGATGCCTATTGCGGTGGAGGTGACAGT AATGAAGGCATCAGCGATCCTTCGATTCCCATTTCTACAGCTGCTCAGGCCAAAATTGCTGCAGCCATCTTCATG GGCGACCCGCGTCACATCCCTGGTTTGTCCTACAATGTCGGAACCTGCCAAGCGAGTGGCTTCGCTCCTCGACCC AATGGCTTCCAGTGCCCACACGCGAGTAACATTCAATCTTACTGCGACGCTGCAGACCCATTCTGCTGCAACGGA AACGACCAGAACACTCACCAGGGCTACGCTGTTGAGTATGGCTCTGCCGCCCTCAACTTTGTCCGGGGCAAAGTC AATGCCATGCTCGGTTAA |
| Gene | >AgabiH97|112390 ATGTCACCCATCCGCTTTGCATCTCTCTTCCTTCTAGGAGCCACTCTCGCTGCTGCCCAGTGTCCACAAGTTCAC ATCTTTGGCGCGCGTGAGACTACTGTTCCTCCCGGCTATGGCACAGCAGGTCCGGTCGTCAACTCCATCATTTCT GCATTCCCAGGAGCCACCGCTGAACCTATTAATTATCCTGCTTGCGGTGGTCAAGCTTCGTGTGGTGGTGTCAGT TATGCCTCCTCCGTTGTTCAAGGTGTAGCTGCTGTAGCTCGCCAAGTGAATTCTTTCAACCAGCAATGCCCCAAT GCAGTCTTGGTCTTGGTTGGTTACTCACAGGTGCTTTGGAGGTCTTTATTTATGCCTTTCGTATATGCTTGCTGA CATGAGCGCGACAGGGCGGTCAACTTTTTGATGATGCCTATTGCGGTGGAGGTGACAGTAATGAAGGCATCAGCG ATCCTTCGATTCCCATTTCTACAGCTGCTCAGGCCAAAATTGCTGCAGCCATCTTCATGGGCGACCCGCGTCACA TCCCTGGTTTGTCCTACAATGTCGGAACCTGCCAAGCGAGTGGCGTTAGTACCCATACCTCAGCCTCCTCATCTC ATCATGTTCTGACCTTAATTTATCTTCCAGTTCGCTCCTCGACCCAATGGCTTCCAGTGCCCACACGCGAGTAAC ATTCAATCTTACTGCGACGCTGCAGACCCATTCTGCTGCAACGGAAACGACCAGAACACTCACCAGGGCTACGCT GTTGAGTATGGCTCTGCCGCCCTCAACTTTGTCCGGGGCAAAGTCAATGCCATGCTCGGTTAA |