Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|112390
Gene name
Locationscaffold_8:1650030..1650843
Strand+
Gene length (bp)813
Transcript length (bp)693
Coding sequence length (bp)693
Protein length (aa) 231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01083 Cutinase Cutinase 1.1E-48 20 224

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59893|AXE2_TALPU Acetylxylan esterase 2 OS=Talaromyces purpurogenus GN=axe-2 PE=1 SV=1 7 225 2.0E-92
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 13 225 2.0E-83

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 7.02 2.77 11.27
Initials Initials knots 3.49 1.11 5.87
Pileal_Stipeal_center Stage I stipe center 8.77 3.70 13.84
Pileal_Stipeal_shell Stage I stipe shell 8.60 3.61 13.59
DIF_stipe_center Stage II stipe center 17.15 8.05 26.25
DIF_stipe_shell Stage II stipe shell 7.34 2.95 11.72
DIF_stipe_skin Stage II stipe skin 6.69 2.65 10.72
DIF_cap_skin Stage II cap skin 8.30 3.45 13.16
DIF_cap_tissue Stage II cap tissue 8.19 3.38 12.99
DIF_gill_tissue Stage II gill tissue 10.89 4.72 17.06
YFB_stipe_center Young fruiting body stipe center 13.73 6.24 21.23
YFB_stipe_shell Young fruiting body stipe shell 12.00 5.25 18.75
YFB_stipe_skin Young fruiting body stipe skin 8.14 3.38 12.89
YFB_cap_skin Young fruiting body cap skin 9.63 4.10 15.16
YFB_cap_tissue Young fruiting body cap tissue 13.09 5.89 20.29
YFB_gill_tissue Young fruiting body gill tissue 10.02 4.31 15.74
YFB_veil Young fruiting body veil 9.13 3.88 14.38

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.347828 no
Casing YFB_stipe_center 0.087080 no
Casing YFB_stipe_shell 0.218974 no
Casing YFB_stipe_skin 0.825118 no
Casing YFB_cap_skin 0.548548 no
Casing YFB_cap_tissue 0.126175 no
Casing YFB_gill_tissue 0.480401 no
Casing YFB_veil 0.636908 no
Casing Initials 0.125287 no
Casing Pileal_Stipeal_center 0.709651 no
Casing Pileal_Stipeal_shell 0.739963 no
Casing DIF_stipe_center 0.013186 yes
Casing DIF_stipe_shell 0.958944 no
Casing DIF_stipe_skin 0.953994 no
Casing DIF_cap_skin 0.799496 no
Casing DIF_cap_tissue 0.815411 no
DIF_gill_tissue YFB_stipe_center 0.673977 no
DIF_gill_tissue YFB_stipe_shell 0.888534 no
DIF_gill_tissue YFB_stipe_skin 0.577040 no
DIF_gill_tissue YFB_cap_skin 0.858718 no
DIF_gill_tissue YFB_cap_tissue 0.756372 no
DIF_gill_tissue YFB_gill_tissue 0.908823 no
DIF_gill_tissue YFB_veil 0.774288 no
YFB_stipe_center YFB_stipe_shell 0.835884 no
YFB_stipe_center YFB_stipe_skin 0.202921 no
YFB_stipe_center YFB_cap_skin 0.458243 no
YFB_stipe_center YFB_cap_tissue 0.948717 no
YFB_stipe_center YFB_gill_tissue 0.526760 no
YFB_stipe_center YFB_veil 0.360096 no
YFB_stipe_shell YFB_stipe_skin 0.408056 no
YFB_stipe_shell YFB_cap_skin 0.704658 no
YFB_stipe_shell YFB_cap_tissue 0.904845 no
YFB_stipe_shell YFB_gill_tissue 0.770298 no
YFB_stipe_shell YFB_veil 0.607221 no
YFB_stipe_skin YFB_cap_skin 0.790635 no
YFB_stipe_skin YFB_cap_tissue 0.271949 no
YFB_stipe_skin YFB_gill_tissue 0.724325 no
YFB_stipe_skin YFB_veil 0.866393 no
YFB_cap_skin YFB_cap_tissue 0.548385 no
YFB_cap_skin YFB_gill_tissue 0.959070 no
YFB_cap_skin YFB_veil 0.943940 no
YFB_cap_tissue YFB_gill_tissue 0.611568 no
YFB_cap_tissue YFB_veil 0.443232 no
YFB_gill_tissue YFB_veil 0.896088 no
Initials DIF_gill_tissue 0.006742 yes
Initials YFB_stipe_center 0.001140 yes
Initials YFB_stipe_shell 0.002951 yes
Initials YFB_stipe_skin 0.052346 no
Initials YFB_cap_skin 0.019442 yes
Initials YFB_cap_tissue 0.002084 yes
Initials YFB_gill_tissue 0.012880 yes
Initials YFB_veil 0.026461 yes
Initials Pileal_Stipeal_center 0.033906 yes
Initials Pileal_Stipeal_shell 0.039390 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.098771 no
Initials DIF_stipe_skin 0.158500 no
Initials DIF_cap_skin 0.046952 yes
Initials DIF_cap_tissue 0.049674 yes
Pileal_Stipeal_center DIF_gill_tissue 0.712799 no
Pileal_Stipeal_center YFB_stipe_center 0.301751 no
Pileal_Stipeal_center YFB_stipe_shell 0.543768 no
Pileal_Stipeal_center YFB_stipe_skin 0.918644 no
Pileal_Stipeal_center YFB_cap_skin 0.900900 no
Pileal_Stipeal_center YFB_cap_tissue 0.383798 no
Pileal_Stipeal_center YFB_gill_tissue 0.843285 no
Pileal_Stipeal_center YFB_veil 0.959321 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.979912 no
Pileal_Stipeal_center DIF_stipe_center 0.071041 no
Pileal_Stipeal_center DIF_stipe_shell 0.781654 no
Pileal_Stipeal_center DIF_stipe_skin 0.630273 no
Pileal_Stipeal_center DIF_cap_skin 0.944499 no
Pileal_Stipeal_center DIF_cap_tissue 0.925532 no
Pileal_Stipeal_shell DIF_gill_tissue 0.675756 no
Pileal_Stipeal_shell YFB_stipe_center 0.274660 no
Pileal_Stipeal_shell YFB_stipe_shell 0.503200 no
Pileal_Stipeal_shell YFB_stipe_skin 0.941994 no
Pileal_Stipeal_shell YFB_cap_skin 0.871867 no
Pileal_Stipeal_shell YFB_cap_tissue 0.353104 no
Pileal_Stipeal_shell YFB_gill_tissue 0.810898 no
Pileal_Stipeal_shell YFB_veil 0.936813 no
Pileal_Stipeal_shell DIF_stipe_center 0.062229 no
Pileal_Stipeal_shell DIF_stipe_shell 0.807483 no
Pileal_Stipeal_shell DIF_stipe_skin 0.658595 no
Pileal_Stipeal_shell DIF_cap_skin 0.965183 no
Pileal_Stipeal_shell DIF_cap_tissue 0.948117 no
DIF_stipe_center DIF_gill_tissue 0.275156 no
DIF_stipe_center YFB_stipe_center 0.665704 no
DIF_stipe_center YFB_stipe_shell 0.429603 no
DIF_stipe_center YFB_stipe_skin 0.037140 yes
DIF_stipe_center YFB_cap_skin 0.136034 no
DIF_stipe_center YFB_cap_tissue 0.580073 no
DIF_stipe_center YFB_gill_tissue 0.175019 no
DIF_stipe_center YFB_veil 0.097608 no
DIF_stipe_center DIF_stipe_shell 0.020790 yes
DIF_stipe_center DIF_stipe_skin 0.010728 yes
DIF_stipe_center DIF_cap_skin 0.044631 yes
DIF_stipe_center DIF_cap_tissue 0.040058 yes
DIF_stipe_shell DIF_gill_tissue 0.416123 no
DIF_stipe_shell YFB_stipe_center 0.123655 no
DIF_stipe_shell YFB_stipe_shell 0.272636 no
DIF_stipe_shell YFB_stipe_skin 0.882516 no
DIF_stipe_shell YFB_cap_skin 0.628392 no
DIF_stipe_shell YFB_cap_tissue 0.168680 no
DIF_stipe_shell YFB_gill_tissue 0.555552 no
DIF_stipe_shell YFB_veil 0.711451 no
DIF_stipe_shell DIF_stipe_skin 0.901200 no
DIF_stipe_shell DIF_cap_skin 0.859011 no
DIF_stipe_shell DIF_cap_tissue 0.874271 no
DIF_stipe_skin DIF_gill_tissue 0.280957 no
DIF_stipe_skin YFB_stipe_center 0.067706 no
DIF_stipe_skin YFB_stipe_shell 0.168544 no
DIF_stipe_skin YFB_stipe_skin 0.750379 no
DIF_stipe_skin YFB_cap_skin 0.474406 no
DIF_stipe_skin YFB_cap_tissue 0.094162 no
DIF_stipe_skin YFB_gill_tissue 0.404591 no
DIF_stipe_skin YFB_veil 0.559424 no
DIF_stipe_skin DIF_cap_skin 0.725231 no
DIF_stipe_skin DIF_cap_tissue 0.741726 no
DIF_cap_skin DIF_gill_tissue 0.615797 no
DIF_cap_skin YFB_stipe_center 0.231862 no
DIF_cap_skin YFB_stipe_shell 0.446701 no
DIF_cap_skin YFB_stipe_skin 0.979095 no
DIF_cap_skin YFB_cap_skin 0.822248 no
DIF_cap_skin YFB_cap_tissue 0.298702 no
DIF_cap_skin YFB_gill_tissue 0.756372 no
DIF_cap_skin YFB_veil 0.894638 no
DIF_cap_skin DIF_cap_tissue 0.985066 no
DIF_cap_tissue DIF_gill_tissue 0.588916 no
DIF_cap_tissue YFB_stipe_center 0.211921 no
DIF_cap_tissue YFB_stipe_shell 0.422433 no
DIF_cap_tissue YFB_stipe_skin 0.991849 no
DIF_cap_tissue YFB_cap_skin 0.800369 no
DIF_cap_tissue YFB_cap_tissue 0.275539 no
DIF_cap_tissue YFB_gill_tissue 0.734225 no
DIF_cap_tissue YFB_veil 0.874431 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|112390
MSPIRFASLFLLGATLAAAQCPQVHIFGARETTVPPGYGTAGPVVNSIISAFPGATAEPINYPACGGQASCGGVS
YASSVVQGVAAVARQVNSFNQQCPNAVLVLVGYSQGGQLFDDAYCGGGDSNEGISDPSIPISTAAQAKIAAAIFM
GDPRHIPGLSYNVGTCQASGFAPRPNGFQCPHASNIQSYCDAADPFCCNGNDQNTHQGYAVEYGSAALNFVRGKV
NAMLG*
Coding >AgabiH97|112390
ATGTCACCCATCCGCTTTGCATCTCTCTTCCTTCTAGGAGCCACTCTCGCTGCTGCCCAGTGTCCACAAGTTCAC
ATCTTTGGCGCGCGTGAGACTACTGTTCCTCCCGGCTATGGCACAGCAGGTCCGGTCGTCAACTCCATCATTTCT
GCATTCCCAGGAGCCACCGCTGAACCTATTAATTATCCTGCTTGCGGTGGTCAAGCTTCGTGTGGTGGTGTCAGT
TATGCCTCCTCCGTTGTTCAAGGTGTAGCTGCTGTAGCTCGCCAAGTGAATTCTTTCAACCAGCAATGCCCCAAT
GCAGTCTTGGTCTTGGTTGGTTACTCACAGGGCGGTCAACTTTTTGATGATGCCTATTGCGGTGGAGGTGACAGT
AATGAAGGCATCAGCGATCCTTCGATTCCCATTTCTACAGCTGCTCAGGCCAAAATTGCTGCAGCCATCTTCATG
GGCGACCCGCGTCACATCCCTGGTTTGTCCTACAATGTCGGAACCTGCCAAGCGAGTGGCTTCGCTCCTCGACCC
AATGGCTTCCAGTGCCCACACGCGAGTAACATTCAATCTTACTGCGACGCTGCAGACCCATTCTGCTGCAACGGA
AACGACCAGAACACTCACCAGGGCTACGCTGTTGAGTATGGCTCTGCCGCCCTCAACTTTGTCCGGGGCAAAGTC
AATGCCATGCTCGGTTAA
Transcript >AgabiH97|112390
ATGTCACCCATCCGCTTTGCATCTCTCTTCCTTCTAGGAGCCACTCTCGCTGCTGCCCAGTGTCCACAAGTTCAC
ATCTTTGGCGCGCGTGAGACTACTGTTCCTCCCGGCTATGGCACAGCAGGTCCGGTCGTCAACTCCATCATTTCT
GCATTCCCAGGAGCCACCGCTGAACCTATTAATTATCCTGCTTGCGGTGGTCAAGCTTCGTGTGGTGGTGTCAGT
TATGCCTCCTCCGTTGTTCAAGGTGTAGCTGCTGTAGCTCGCCAAGTGAATTCTTTCAACCAGCAATGCCCCAAT
GCAGTCTTGGTCTTGGTTGGTTACTCACAGGGCGGTCAACTTTTTGATGATGCCTATTGCGGTGGAGGTGACAGT
AATGAAGGCATCAGCGATCCTTCGATTCCCATTTCTACAGCTGCTCAGGCCAAAATTGCTGCAGCCATCTTCATG
GGCGACCCGCGTCACATCCCTGGTTTGTCCTACAATGTCGGAACCTGCCAAGCGAGTGGCTTCGCTCCTCGACCC
AATGGCTTCCAGTGCCCACACGCGAGTAACATTCAATCTTACTGCGACGCTGCAGACCCATTCTGCTGCAACGGA
AACGACCAGAACACTCACCAGGGCTACGCTGTTGAGTATGGCTCTGCCGCCCTCAACTTTGTCCGGGGCAAAGTC
AATGCCATGCTCGGTTAA
Gene >AgabiH97|112390
ATGTCACCCATCCGCTTTGCATCTCTCTTCCTTCTAGGAGCCACTCTCGCTGCTGCCCAGTGTCCACAAGTTCAC
ATCTTTGGCGCGCGTGAGACTACTGTTCCTCCCGGCTATGGCACAGCAGGTCCGGTCGTCAACTCCATCATTTCT
GCATTCCCAGGAGCCACCGCTGAACCTATTAATTATCCTGCTTGCGGTGGTCAAGCTTCGTGTGGTGGTGTCAGT
TATGCCTCCTCCGTTGTTCAAGGTGTAGCTGCTGTAGCTCGCCAAGTGAATTCTTTCAACCAGCAATGCCCCAAT
GCAGTCTTGGTCTTGGTTGGTTACTCACAGGTGCTTTGGAGGTCTTTATTTATGCCTTTCGTATATGCTTGCTGA
CATGAGCGCGACAGGGCGGTCAACTTTTTGATGATGCCTATTGCGGTGGAGGTGACAGTAATGAAGGCATCAGCG
ATCCTTCGATTCCCATTTCTACAGCTGCTCAGGCCAAAATTGCTGCAGCCATCTTCATGGGCGACCCGCGTCACA
TCCCTGGTTTGTCCTACAATGTCGGAACCTGCCAAGCGAGTGGCGTTAGTACCCATACCTCAGCCTCCTCATCTC
ATCATGTTCTGACCTTAATTTATCTTCCAGTTCGCTCCTCGACCCAATGGCTTCCAGTGCCCACACGCGAGTAAC
ATTCAATCTTACTGCGACGCTGCAGACCCATTCTGCTGCAACGGAAACGACCAGAACACTCACCAGGGCTACGCT
GTTGAGTATGGCTCTGCCGCCCTCAACTTTGTCCGGGGCAAAGTCAATGCCATGCTCGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail