Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|112380
Gene name
Locationscaffold_8:1644542..1646217
Strand-
Gene length (bp)1675
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05631 MFS_5 Sugar-tranasporters, 12 TM 1.4E-73 65 379
PF07690 MFS_1 Major Facilitator Superfamily 1.4E-17 74 422

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1KKV8|MFSD5_TAKRU Molybdate-anion transporter OS=Takifugu rubripes GN=mfsd5 PE=3 SV=1 23 424 4.0E-41
sp|Q6N075|MFSD5_HUMAN Molybdate-anion transporter OS=Homo sapiens GN=MFSD5 PE=1 SV=2 56 479 6.0E-38
sp|Q921Y4|MFSD5_MOUSE Molybdate-anion transporter OS=Mus musculus GN=Mfsd5 PE=2 SV=1 56 479 6.0E-38
sp|Q0VC03|MFSD5_BOVIN Molybdate-anion transporter OS=Bos taurus GN=MFSD5 PE=2 SV=1 47 479 2.0E-37
sp|Q5R542|MFSD5_PONAB Molybdate-anion transporter OS=Pongo abelii GN=MFSD5 PE=2 SV=1 56 479 1.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1KKV8|MFSD5_TAKRU Molybdate-anion transporter OS=Takifugu rubripes GN=mfsd5 PE=3 SV=1 23 424 4.0E-41
sp|Q6N075|MFSD5_HUMAN Molybdate-anion transporter OS=Homo sapiens GN=MFSD5 PE=1 SV=2 56 479 6.0E-38
sp|Q921Y4|MFSD5_MOUSE Molybdate-anion transporter OS=Mus musculus GN=Mfsd5 PE=2 SV=1 56 479 6.0E-38
sp|Q0VC03|MFSD5_BOVIN Molybdate-anion transporter OS=Bos taurus GN=MFSD5 PE=2 SV=1 47 479 2.0E-37
sp|Q5R542|MFSD5_PONAB Molybdate-anion transporter OS=Pongo abelii GN=MFSD5 PE=2 SV=1 56 479 1.0E-35
sp|Q6DG19|MFSD5_DANRE Molybdate-anion transporter OS=Danio rerio GN=mfsd5 PE=2 SV=1 24 424 1.0E-34
sp|Q08B29|MFSD5_XENLA Molybdate-anion transporter OS=Xenopus laevis GN=mfsd5 PE=2 SV=1 56 479 2.0E-33
sp|Q28E13|MFSD5_XENTR Molybdate-anion transporter OS=Xenopus tropicalis GN=mfsd5 PE=2 SV=1 56 479 2.0E-31
[Show less]

GO

GO Term Description Terminal node
GO:0015098 molybdate ion transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0015689 molybdate ion transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0015698 inorganic anion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0006820 anion transport No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0009987 cellular process No
GO:0015075 ion transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0006811 ion transport No
GO:0051179 localization No
GO:0008509 anion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 72 94 22
3 104 126 22
4 139 161 22
5 222 244 22
6 282 304 22
7 319 341 22
8 443 465 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|112380
MGLTTLHSRFSDGGFYQFWLVVFALLCLTLLCVERYVTGKGKDKSKESADDRLESARPACSGSALGVLAKKYLVV
YAIVMAADWLQGPYIYSLYREQYGFPERMVALFFVTGFVSGGMAAPLVGAWADQHGRKKLCLAFCLSYISTCVLS
LFPVLPVLLVGRLCGGISGSILYSAFESWLISSASSVGLSNGDLSTILGRATLVNGFVATGAGVFSNKLVATTHN
FASPMVASGCLLVVGFLVIRATWSENYGTLDGSPTKDLWQTKRLSHAWKIAYNDPMLLTLGLMQTCFEGSMYLFV
FVWVPSLQEATHSPDALPLGYIFSSFMVSIMIGSIFYNLIATYTKRNEVDSSLTTHAKLSSLVCALSSLAFAACV
SSKSEQVRFFAFCAFEACVGVYYPAQGMLRGTLISNEHRATLSSLFRVPLNIFVVISLMTGVSSARQAVLSACAI
ILGFSSLMAGFYLVGKSEEVAVGNGAARP*
Coding >AgabiH97|112380
ATGGGTCTCACGACTCTGCATTCTCGATTCTCAGACGGCGGCTTTTATCAGTTCTGGCTTGTAGTGTTCGCCCTG
CTCTGTTTGACCCTTTTATGCGTGGAGAGATACGTGACGGGCAAGGGCAAAGACAAGTCGAAGGAAAGCGCCGAT
GACAGACTCGAGAGCGCGCGCCCTGCCTGCTCTGGAAGCGCGCTAGGAGTTCTTGCGAAGAAGTACCTGGTTGTG
TACGCCATTGTCATGGCTGCAGACTGGCTACAAGGCCCATACATTTACTCATTGTATAGGGAACAGTATGGCTTC
CCTGAGAGGATGGTAGCGTTGTTCTTCGTGACGGGATTTGTCTCTGGAGGGATGGCGGCGCCTCTTGTGGGTGCA
TGGGCGGATCAACATGGCCGCAAAAAGCTCTGTCTAGCATTCTGCCTGAGCTATATTTCTACATGCGTTCTATCA
CTCTTTCCTGTCCTGCCTGTTCTACTCGTCGGTCGTCTCTGCGGTGGCATATCGGGATCTATACTATACTCTGCG
TTTGAATCGTGGTTAATATCTTCTGCTTCATCTGTCGGTCTTTCAAATGGGGATTTGTCGACTATTTTAGGTCGC
GCGACGCTCGTTAATGGGTTTGTGGCCACTGGTGCTGGAGTGTTTAGTAACAAACTCGTTGCTACAACACATAAT
TTCGCCTCTCCGATGGTTGCGAGTGGATGCTTGCTCGTGGTGGGATTTCTTGTGATCCGCGCGACATGGTCGGAA
AATTATGGAACTCTGGATGGATCACCGACAAAAGACCTCTGGCAGACGAAGAGATTGTCACATGCATGGAAAATT
GCCTACAATGATCCTATGTTGTTGACCCTTGGGTTGATGCAAACATGCTTCGAAGGCTCTATGTACTTATTCGTA
TTCGTGTGGGTGCCGTCGCTTCAAGAGGCGACCCACTCGCCAGACGCTTTACCGCTTGGTTACATCTTTTCGTCA
TTCATGGTCTCAATCATGATAGGCTCCATCTTCTATAACCTCATTGCGACCTATACAAAACGCAACGAGGTTGAT
TCATCATTGACGACCCATGCTAAACTCAGCAGTCTTGTTTGCGCCTTGAGTTCCTTGGCGTTCGCAGCTTGTGTA
TCGTCGAAGAGCGAGCAAGTGCGATTCTTTGCGTTTTGCGCGTTCGAGGCTTGTGTAGGCGTGTACTACCCTGCA
CAGGGTATGCTGCGGGGAACATTGATATCAAATGAGCATCGGGCAACGCTTTCTTCTTTGTTCCGCGTGCCGCTC
AACATCTTTGTTGTGATCTCGCTCATGACTGGCGTGTCATCAGCTCGACAAGCCGTGCTCAGCGCTTGTGCAATT
ATACTCGGTTTCTCGTCACTCATGGCGGGCTTCTATCTTGTTGGCAAGTCAGAAGAGGTAGCAGTTGGGAATGGC
GCTGCTCGGCCTTGA
Transcript >AgabiH97|112380
ATGGGTCTCACGACTCTGCATTCTCGATTCTCAGACGGCGGCTTTTATCAGTTCTGGCTTGTAGTGTTCGCCCTG
CTCTGTTTGACCCTTTTATGCGTGGAGAGATACGTGACGGGCAAGGGCAAAGACAAGTCGAAGGAAAGCGCCGAT
GACAGACTCGAGAGCGCGCGCCCTGCCTGCTCTGGAAGCGCGCTAGGAGTTCTTGCGAAGAAGTACCTGGTTGTG
TACGCCATTGTCATGGCTGCAGACTGGCTACAAGGCCCATACATTTACTCATTGTATAGGGAACAGTATGGCTTC
CCTGAGAGGATGGTAGCGTTGTTCTTCGTGACGGGATTTGTCTCTGGAGGGATGGCGGCGCCTCTTGTGGGTGCA
TGGGCGGATCAACATGGCCGCAAAAAGCTCTGTCTAGCATTCTGCCTGAGCTATATTTCTACATGCGTTCTATCA
CTCTTTCCTGTCCTGCCTGTTCTACTCGTCGGTCGTCTCTGCGGTGGCATATCGGGATCTATACTATACTCTGCG
TTTGAATCGTGGTTAATATCTTCTGCTTCATCTGTCGGTCTTTCAAATGGGGATTTGTCGACTATTTTAGGTCGC
GCGACGCTCGTTAATGGGTTTGTGGCCACTGGTGCTGGAGTGTTTAGTAACAAACTCGTTGCTACAACACATAAT
TTCGCCTCTCCGATGGTTGCGAGTGGATGCTTGCTCGTGGTGGGATTTCTTGTGATCCGCGCGACATGGTCGGAA
AATTATGGAACTCTGGATGGATCACCGACAAAAGACCTCTGGCAGACGAAGAGATTGTCACATGCATGGAAAATT
GCCTACAATGATCCTATGTTGTTGACCCTTGGGTTGATGCAAACATGCTTCGAAGGCTCTATGTACTTATTCGTA
TTCGTGTGGGTGCCGTCGCTTCAAGAGGCGACCCACTCGCCAGACGCTTTACCGCTTGGTTACATCTTTTCGTCA
TTCATGGTCTCAATCATGATAGGCTCCATCTTCTATAACCTCATTGCGACCTATACAAAACGCAACGAGGTTGAT
TCATCATTGACGACCCATGCTAAACTCAGCAGTCTTGTTTGCGCCTTGAGTTCCTTGGCGTTCGCAGCTTGTGTA
TCGTCGAAGAGCGAGCAAGTGCGATTCTTTGCGTTTTGCGCGTTCGAGGCTTGTGTAGGCGTGTACTACCCTGCA
CAGGGTATGCTGCGGGGAACATTGATATCAAATGAGCATCGGGCAACGCTTTCTTCTTTGTTCCGCGTGCCGCTC
AACATCTTTGTTGTGATCTCGCTCATGACTGGCGTGTCATCAGCTCGACAAGCCGTGCTCAGCGCTTGTGCAATT
ATACTCGGTTTCTCGTCACTCATGGCGGGCTTCTATCTTGTTGGCAAGTCAGAAGAGGTAGCAGTTGGGAATGGC
GCTGCTCGGCCTTGA
Gene >AgabiH97|112380
ATGGGTCTCACGACTCTGCATTCTCGATTCTCAGACGGCGGCTTTTATCAGTTCTGGCTTGTAGTGTTCGCCCTG
CTCTGTTTGACCCTTTTATGCGTGGAGAGATACGTGACGGGCAAGGGCAAAGACAAGTCGAAGGAAAGCGCCGAT
GACAGACTCGAGAGCGCGCGCCCTGCCTGCTCTGGAAGCGCGCTAGGAGTTCTTGCGAAGAAGTACCTGGTTGTG
TACGCCATTGTCATGGGTATGTTAGTCGTGTTTACTTCCACAAGGTGGTGCTGACGCGGGATATGGCATCAGCTG
CAGACTGGCTACAAGGCCCATACATTTACTCATTGTATAGGGAACAGTATGGCTTCCCTGAGAGGATGGTAGCGT
TGTTCTTCGTGACGGGATTTGTCTCTGGAGGGATGGCGGCGCCTCTTGTGGGTGCATGGGCGGATCAACAGTTAG
TACATTGTACCCCCGGGCGGTCAGAACATTCTGATTTCAAATTCCTCCCAACAGTGGCCGCAAAAAGCTCTGTCT
AGCATTCTGCCTGAGCTATATTTCTACATGCGTTCTATCACTCTTTCCTGTCCTGCCTGTTCTACTCGTCGGTCG
TCTCTGCGGTGGCATATCGGGATCTATACTATACTCTGCGTTTGAATCGTGGTTAATATCTTCTGCTTCATCTGT
CGGTCTTTCAAATGGGGATTTGTCGACTATTTTAGGTCGCGCGACGCTCGTTAATGGGTTTGTGGCCACTGGTGC
TGGAGTGTTTAGTAACAAACTCGTTGCTACAACACATAATTTCGCCTCTCCGATGGTTGCGAGTGGATGCTTGCT
CGTGGTGGGATTTCTTGTGATCCGCGCGACATGGTCGGAAAATTATGGAACTCTGGATGGATCACCGACAAAAGA
CCTCTGGCAGACGAAGAGATTGTCACATGCATGGAAAATTGCCTACAATGGTGCGTTGGCAAACAGCCCTGAACC
GCTTCGCGGATCTTGACATTGTTGCCCGCTAGATCCTATGTTGTTGACCCTTGGGTTGATGCAAACATGCTTCGA
AGGCTCTATGTACTTATTCGTATTCGTGTGGGTGCCGTCGCTTCAAGAGGCGACCCACTCGCCAGACGCTTTACC
GCTTGGTTACATCTTTTCGTCATTCATGGTCTCAATCATGATAGGCTCCATCTTCTATAACCTCATTGCGACCTA
TACAAAACGCAACGAGGTTGATTCATCATTGACGACCCATGCTAAACTCAGCAGTCTTGTTTGCGCCTTGAGTTC
CTTGGCGTTCGCAGCTTGTGTATCGTCGAAGAGCGAGCAAGTGCGATTCTTTGCGTTTTGCGCGTTCGAGGCTTG
TGTAGGCGTGTACTACCCTGCACAGGGTATGCTGCGGGGAACATTGATATCAAATGAGCATCGGGCAACGGTAAA
ATTATTTTTTTGATACCAGATCATGATGCTGATGGAATTCGGAAATTTTGTTTGATAGCTTTCTTCTTTGTTCCG
CGTGCCGCTCAACATCTTTGTTGTGATCTCGCTCATGACTGGCGTGTCATCAGCTCGACAAGCCGTGCTCAGCGC
TTGTGCAATTATACTCGGTTTCTCGTCACTCATGGCGGGCTTCTATCTTGTTGGCAAGTCAGAAGAGGTAGCAGT
TGGGAATGGCGCTGCTCGGCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail