Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|111720
Gene name
Locationscaffold_8:1467630..1468677
Strand-
Gene length (bp)1047
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 2.7E-34 4 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12040|YO283_YEAST Broad-specificity phosphatase YOR283W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR283W PE=1 SV=1 1 173 6.0E-17
sp|Q4V7R0|TIGAR_XENLA Fructose-2,6-bisphosphatase TIGAR OS=Xenopus laevis GN=tigar PE=2 SV=1 4 99 6.0E-17
sp|B1WAX6|TIGAR_XENTR Fructose-2,6-bisphosphatase TIGAR OS=Xenopus tropicalis GN=tigar PE=2 SV=1 4 171 2.0E-16
sp|B9JYQ2|GPMA_AGRVS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gpmA PE=3 SV=1 3 186 9.0E-16
sp|Q8L1Z7|GPMA_BARHE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gpmA PE=3 SV=1 3 186 1.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12040|YO283_YEAST Broad-specificity phosphatase YOR283W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR283W PE=1 SV=1 1 173 6.0E-17
sp|Q4V7R0|TIGAR_XENLA Fructose-2,6-bisphosphatase TIGAR OS=Xenopus laevis GN=tigar PE=2 SV=1 4 99 6.0E-17
sp|B1WAX6|TIGAR_XENTR Fructose-2,6-bisphosphatase TIGAR OS=Xenopus tropicalis GN=tigar PE=2 SV=1 4 171 2.0E-16
sp|B9JYQ2|GPMA_AGRVS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gpmA PE=3 SV=1 3 186 9.0E-16
sp|Q8L1Z7|GPMA_BARHE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gpmA PE=3 SV=1 3 186 1.0E-15
sp|A1JJB8|GPMB_YERE8 Probable phosphoglycerate mutase GpmB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gpmB PE=3 SV=1 1 205 4.0E-15
sp|B5ZWT2|GPMA_RHILW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gpmA PE=3 SV=1 3 186 4.0E-15
sp|Q8BZA9|TIGAR_MOUSE Fructose-2,6-bisphosphatase TIGAR OS=Mus musculus GN=Tigar PE=1 SV=1 4 99 9.0E-15
sp|P36623|PMGY_SCHPO Phosphoglycerate mutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpm1 PE=1 SV=1 4 180 1.0E-14
sp|Q8YDC9|GPMA_BRUME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gpmA PE=3 SV=2 3 200 1.0E-14
sp|C0RMJ1|GPMA_BRUMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gpmA PE=3 SV=1 3 200 1.0E-14
sp|A5VVV5|GPMA_BRUO2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gpmA PE=3 SV=1 3 200 2.0E-14
sp|P59160|GPMA_BRUSU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis biovar 1 (strain 1330) GN=gpmA PE=3 SV=1 3 200 2.0E-14
sp|A9WW62|GPMA_BRUSI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gpmA PE=3 SV=1 3 200 2.0E-14
sp|A9MCX8|GPMA_BRUC2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gpmA PE=3 SV=1 3 200 2.0E-14
sp|Q576R3|GPMA_BRUAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus biovar 1 (strain 9-941) GN=gpmA PE=3 SV=1 3 200 2.0E-14
sp|Q2YJN6|GPMA_BRUA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain 2308) GN=gpmA PE=3 SV=1 3 200 2.0E-14
sp|B2SC37|GPMA_BRUA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain S19) GN=gpmA PE=3 SV=1 3 200 2.0E-14
sp|Q38ZH8|GPMA1_LACSS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gpmA1 PE=3 SV=1 1 187 2.0E-14
sp|Q1JQA7|TIGAR_BOVIN Fructose-2,6-bisphosphatase TIGAR OS=Bos taurus GN=TIGAR PE=2 SV=1 4 99 3.0E-14
sp|Q7NJF7|GPMA2_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA2 PE=3 SV=1 1 222 4.0E-14
sp|Q2YBZ1|GPMA1_NITMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gpmA1 PE=3 SV=1 1 125 6.0E-14
sp|A9IXE7|GPMA_BART1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gpmA PE=3 SV=1 3 186 6.0E-14
sp|A8G9J4|GPMB_SERP5 Probable phosphoglycerate mutase GpmB OS=Serratia proteamaculans (strain 568) GN=gpmB PE=3 SV=1 1 183 7.0E-14
sp|A4W6B3|GPMB_ENT38 Probable phosphoglycerate mutase GpmB OS=Enterobacter sp. (strain 638) GN=gpmB PE=3 SV=1 1 183 8.0E-14
sp|B9J6R3|GPMA_AGRRK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=gpmA PE=3 SV=1 3 186 9.0E-14
sp|Q7ZVE3|TIGRB_DANRE Fructose-2,6-bisphosphatase TIGAR B OS=Danio rerio GN=tigarb PE=1 SV=2 4 149 1.0E-13
sp|Q6FZ12|GPMA_BARQU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella quintana (strain Toulouse) GN=gpmA PE=3 SV=1 3 186 1.0E-13
sp|Q732Z5|GPMA2_BACC1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gpmA2 PE=3 SV=1 1 190 1.0E-13
sp|B3PXK3|GPMA_RHIE6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium etli (strain CIAT 652) GN=gpmA PE=3 SV=1 3 186 2.0E-13
sp|Q7N900|GPMB_PHOLL Probable phosphoglycerate mutase GpmB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpmB PE=3 SV=1 1 205 2.0E-13
sp|B7LNT7|GPMB_ESCF3 Probable phosphoglycerate mutase GpmB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gpmB PE=3 SV=1 1 183 2.0E-13
sp|A1UTM4|GPMA_BARBK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gpmA PE=3 SV=1 3 186 2.0E-13
sp|B4EY52|GPMB_PROMH Probable phosphoglycerate mutase GpmB OS=Proteus mirabilis (strain HI4320) GN=gpmB PE=3 SV=1 1 183 2.0E-13
sp|B8EML2|GPMA_METSB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gpmA PE=3 SV=1 4 186 3.0E-13
sp|A9MR94|GPMB_SALAR Probable phosphoglycerate mutase GpmB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gpmB PE=3 SV=1 1 183 3.0E-13
sp|A6WYJ2|GPMA_OCHA4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gpmA PE=3 SV=1 3 192 4.0E-13
sp|B0UBD4|GPMA_METS4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium sp. (strain 4-46) GN=gpmA PE=3 SV=1 4 180 4.0E-13
sp|B1JL20|GPMB_YERPY Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gpmB PE=3 SV=1 1 205 4.0E-13
sp|Q66EU3|GPMB_YERPS Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gpmB PE=3 SV=1 1 205 4.0E-13
sp|A4TQH5|GPMB_YERPP Probable phosphoglycerate mutase GpmB OS=Yersinia pestis (strain Pestoides F) GN=gpmB PE=3 SV=1 1 205 4.0E-13
sp|Q1CMX2|GPMB_YERPN Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gpmB PE=3 SV=1 1 205 4.0E-13
sp|A9R032|GPMB_YERPG Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gpmB PE=3 SV=1 1 205 4.0E-13
sp|Q8ZIP0|GPMB_YERPE Probable phosphoglycerate mutase GpmB OS=Yersinia pestis GN=gpmB PE=3 SV=1 1 205 4.0E-13
sp|B2K3K5|GPMB_YERPB Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gpmB PE=3 SV=1 1 205 4.0E-13
sp|Q1C0L5|GPMB_YERPA Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gpmB PE=3 SV=1 1 205 4.0E-13
sp|A7FMF8|GPMB_YERP3 Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gpmB PE=3 SV=1 1 205 4.0E-13
sp|C3MBY8|GPMA_RHISN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium sp. (strain NGR234) GN=gpmA PE=3 SV=1 3 186 7.0E-13
sp|Q57G26|GPMB_SALCH Probable phosphoglycerate mutase GpmB OS=Salmonella choleraesuis (strain SC-B67) GN=gpmB PE=3 SV=1 1 183 7.0E-13
sp|Q1MMY4|GPMA_RHIL3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gpmA PE=3 SV=1 3 186 9.0E-13
sp|B5Y264|GPMB_KLEP3 Probable phosphoglycerate mutase GpmB OS=Klebsiella pneumoniae (strain 342) GN=gpmB PE=3 SV=1 1 183 9.0E-13
sp|A6TI09|GPMB_KLEP7 Probable phosphoglycerate mutase GpmB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gpmB PE=3 SV=1 1 183 1.0E-12
sp|B2VH13|GPMB_ERWT9 Probable phosphoglycerate mutase GpmB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gpmB PE=3 SV=1 1 189 1.0E-12
sp|Q8ZJU8|GPMB_SALTY Probable phosphoglycerate mutase GpmB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpmB PE=3 SV=1 1 183 1.0E-12
sp|B4TU55|GPMB_SALSV Probable phosphoglycerate mutase GpmB OS=Salmonella schwarzengrund (strain CVM19633) GN=gpmB PE=3 SV=1 1 183 1.0E-12
sp|A9N7F5|GPMB_SALPB Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gpmB PE=3 SV=1 1 183 1.0E-12
sp|Q5PK44|GPMB_SALPA Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gpmB PE=3 SV=1 1 183 1.0E-12
sp|B4T4I9|GPMB_SALNS Probable phosphoglycerate mutase GpmB OS=Salmonella newport (strain SL254) GN=gpmB PE=3 SV=1 1 183 1.0E-12
sp|B4TH18|GPMB_SALHS Probable phosphoglycerate mutase GpmB OS=Salmonella heidelberg (strain SL476) GN=gpmB PE=3 SV=1 1 183 1.0E-12
sp|B5R9W3|GPMB_SALG2 Probable phosphoglycerate mutase GpmB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gpmB PE=3 SV=1 1 183 1.0E-12
sp|B5R3B7|GPMB_SALEP Probable phosphoglycerate mutase GpmB OS=Salmonella enteritidis PT4 (strain P125109) GN=gpmB PE=3 SV=1 1 183 1.0E-12
sp|B5FTD9|GPMB_SALDC Probable phosphoglycerate mutase GpmB OS=Salmonella dublin (strain CT_02021853) GN=gpmB PE=3 SV=1 1 183 1.0E-12
sp|B5F543|GPMB_SALA4 Probable phosphoglycerate mutase GpmB OS=Salmonella agona (strain SL483) GN=gpmB PE=3 SV=1 1 183 1.0E-12
sp|A9KN01|GPMA_CLOPH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=gpmA PE=3 SV=1 2 186 1.0E-12
sp|Q1R246|GPMB_ECOUT Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain UTI89 / UPEC) GN=gpmB PE=3 SV=1 1 183 2.0E-12
sp|Q8FA40|GPMB_ECOL6 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gpmB PE=3 SV=1 1 183 2.0E-12
sp|Q0T8R6|GPMB_ECOL5 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gpmB PE=3 SV=1 1 183 2.0E-12
sp|A1AJW4|GPMB_ECOK1 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O1:K1 / APEC GN=gpmB PE=3 SV=1 1 183 2.0E-12
sp|B7MTE3|GPMB_ECO81 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O81 (strain ED1a) GN=gpmB PE=3 SV=1 1 183 2.0E-12
sp|B7NW76|GPMB_ECO7I Probable phosphoglycerate mutase GpmB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gpmB PE=3 SV=1 1 183 2.0E-12
sp|B7MNK4|GPMB_ECO45 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gpmB PE=3 SV=1 1 183 2.0E-12
sp|C0Q8F5|GPMB_SALPC Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi C (strain RKS4594) GN=gpmB PE=3 SV=1 1 183 2.0E-12
sp|Q8Z0T4|GPMB_SALTI Probable phosphoglycerate mutase GpmB OS=Salmonella typhi GN=gpmB PE=3 SV=1 1 183 3.0E-12
sp|Q83FQ7|GPMA_TROWT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Tropheryma whipplei (strain Twist) GN=gpmA PE=3 SV=1 1 176 3.0E-12
sp|Q83HD5|GPMA_TROW8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Tropheryma whipplei (strain TW08/27) GN=gpmA PE=3 SV=1 1 176 3.0E-12
sp|A6UEW3|GPMA_SINMW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sinorhizobium medicae (strain WSM419) GN=gpmA PE=3 SV=1 3 186 5.0E-12
sp|Q3YTZ9|GPMB_SHISS Probable phosphoglycerate mutase GpmB OS=Shigella sonnei (strain Ss046) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|P0A7A4|GPMB_SHIFL Probable phosphoglycerate mutase GpmB OS=Shigella flexneri GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|Q0SX17|GPMB_SHIF8 Probable phosphoglycerate mutase GpmB OS=Shigella flexneri serotype 5b (strain 8401) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|B1LEK2|GPMB_ECOSM Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|B6I6P3|GPMB_ECOSE Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain SE11) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|B7NH70|GPMB_ECOLU Probable phosphoglycerate mutase GpmB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|P0A7A2|GPMB_ECOLI Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|B1IS24|GPMB_ECOLC Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|A8A8C4|GPMB_ECOHS Probable phosphoglycerate mutase GpmB OS=Escherichia coli O9:H4 (strain HS) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|B1XFK5|GPMB_ECODH Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12 / DH10B) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|C4ZT77|GPMB_ECOBW Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|B7LXV9|GPMB_ECO8A Probable phosphoglycerate mutase GpmB OS=Escherichia coli O8 (strain IAI1) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|B5Z4S7|GPMB_ECO5E Probable phosphoglycerate mutase GpmB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|P0A7A3|GPMB_ECO57 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O157:H7 GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|B7LEP1|GPMB_ECO55 Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain 55989 / EAEC) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|A7ZVT7|GPMB_ECO24 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|Q31SU3|GPMB_SHIBS Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|B2TZS8|GPMB_SHIB3 Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gpmB PE=3 SV=1 1 183 5.0E-12
sp|Q6D7E3|GPMA_PECAS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gpmA PE=3 SV=1 1 180 7.0E-12
sp|A4W897|GPMA_ENT38 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Enterobacter sp. (strain 638) GN=gpmA PE=3 SV=1 1 186 7.0E-12
sp|Q88YY8|GPMA1_LACPL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gpmA1 PE=3 SV=1 1 96 8.0E-12
sp|Q92T25|GPMA_RHIME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium meliloti (strain 1021) GN=gpmA PE=3 SV=1 3 186 8.0E-12
sp|A7MIJ0|GPMB_CROS8 Probable phosphoglycerate mutase GpmB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmB PE=3 SV=1 1 183 1.0E-11
sp|Q8RFG9|GPMA_FUSNN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gpmA PE=3 SV=1 2 186 1.0E-11
sp|A4YJP8|GPMA_BRASO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain ORS278) GN=gpmA PE=3 SV=1 4 186 2.0E-11
sp|Q7MXP1|GPMA_PORGI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=gpmA PE=3 SV=1 1 186 2.0E-11
sp|B2RHB7|GPMA_PORG3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=gpmA PE=3 SV=1 1 186 2.0E-11
sp|A8ALW1|GPMB_CITK8 Probable phosphoglycerate mutase GpmB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gpmB PE=3 SV=1 1 183 2.0E-11
sp|B5BAL1|GPMB_SALPK Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain AKU_12601) GN=gpmB PE=3 SV=1 1 183 3.0E-11
sp|Q7VR80|GPMA_BLOFL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Blochmannia floridanus GN=gpmA PE=3 SV=1 1 184 3.0E-11
sp|Q9NQ88|TIGAR_HUMAN Fructose-2,6-bisphosphatase TIGAR OS=Homo sapiens GN=TIGAR PE=1 SV=1 4 99 3.0E-11
sp|A6L9K8|GPMA_PARD8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=gpmA PE=3 SV=1 1 186 3.0E-11
sp|A9VFW9|GPMA_BACWK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus weihenstephanensis (strain KBAB4) GN=gpmA PE=3 SV=1 1 180 3.0E-11
sp|B8GFF8|GPMA_METPE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=gpmA PE=3 SV=1 1 180 3.0E-11
sp|B2IEV6|GPMA_BEII9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gpmA PE=3 SV=1 4 186 3.0E-11
sp|Q327K0|GPMB_SHIDS Probable phosphoglycerate mutase GpmB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gpmB PE=3 SV=1 1 183 3.0E-11
sp|Q64R85|GPMA_BACFR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacteroides fragilis (strain YCH46) GN=gpmA PE=3 SV=1 1 190 3.0E-11
sp|Q5LAT7|GPMA_BACFN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=gpmA PE=3 SV=1 1 190 3.0E-11
sp|B1ZA86|GPMA_METPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gpmA PE=3 SV=1 4 180 4.0E-11
sp|C6DCF6|GPMA_PECCP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=gpmA PE=3 SV=1 1 180 4.0E-11
sp|A7HZ35|GPMA_PARL1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gpmA PE=3 SV=1 4 186 4.0E-11
sp|A6US15|GPMA_METVS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=gpmA PE=3 SV=1 1 186 4.0E-11
sp|Q492W5|GPMA_BLOPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Blochmannia pennsylvanicus (strain BPEN) GN=gpmA PE=3 SV=1 1 184 5.0E-11
sp|B1M6A7|GPMA_METRJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=gpmA PE=3 SV=1 4 180 5.0E-11
sp|A7IC75|GPMA_XANP2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gpmA PE=3 SV=1 4 186 8.0E-11
sp|Q256A6|GPMA_CHLFF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydophila felis (strain Fe/C-56) GN=gpmA PE=3 SV=1 1 186 8.0E-11
sp|A1JRT1|GPMA_YERE8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gpmA PE=3 SV=1 1 186 9.0E-11
sp|A5E8K1|GPMA_BRASB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gpmA PE=3 SV=1 4 186 1.0E-10
sp|Q98DM0|GPMA_RHILO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium loti (strain MAFF303099) GN=gpmA PE=3 SV=1 3 180 1.0E-10
sp|Q07UT3|GPMA_RHOP5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodopseudomonas palustris (strain BisA53) GN=gpmA PE=3 SV=1 4 186 1.0E-10
sp|Q3SW71|GPMA_NITWN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gpmA PE=3 SV=1 4 186 2.0E-10
sp|Q73M14|GPMA_TREDE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gpmA PE=3 SV=1 2 95 2.0E-10
sp|O07617|PHOE_BACSU Uncharacterized phosphatase PhoE OS=Bacillus subtilis (strain 168) GN=phoE PE=3 SV=1 1 220 2.0E-10
sp|Q1QRT7|GPMA_NITHX 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gpmA PE=3 SV=1 4 186 2.0E-10
sp|A9W5P5|GPMA_METEP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium extorquens (strain PA1) GN=gpmA PE=3 SV=1 4 180 2.0E-10
sp|B7KNX9|GPMA_METC4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=gpmA PE=3 SV=1 4 180 2.0E-10
sp|Q74L45|GPMA2_LACJO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gpmA2 PE=3 SV=1 1 180 2.0E-10
sp|Q49ZZ2|GPMA_STAS1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gpmA PE=3 SV=1 1 142 2.0E-10
sp|B6JCI9|GPMA_OLICO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gpmA PE=3 SV=1 4 186 2.0E-10
sp|C0QV47|GPMA_BRAHW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=gpmA PE=3 SV=1 1 180 2.0E-10
sp|Q8CN61|GPMA_STAES 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gpmA PE=3 SV=1 1 186 2.0E-10
sp|A6T6I3|GPMA_KLEP7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gpmA PE=3 SV=1 1 180 3.0E-10
sp|B5XZB2|GPMA_KLEP3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Klebsiella pneumoniae (strain 342) GN=gpmA PE=3 SV=1 1 180 3.0E-10
sp|Q9PLK4|GPMA_CHLMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gpmA PE=3 SV=1 1 186 3.0E-10
sp|B2S2B5|GPMA_TREPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=gpmA PE=3 SV=1 2 184 4.0E-10
sp|P96121|GPMA_TREPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum (strain Nichols) GN=gpmA PE=3 SV=1 2 184 4.0E-10
sp|Q9Z743|GPMA_CHLPN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia pneumoniae GN=gpmA PE=3 SV=1 1 186 4.0E-10
sp|B0BAH7|GPMA_CHLTB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=gpmA PE=3 SV=1 1 186 5.0E-10
sp|Q5ZLN1|PGAM1_CHICK Phosphoglycerate mutase 1 OS=Gallus gallus GN=PGAM1 PE=1 SV=3 4 170 5.0E-10
sp|Q8A8R2|GPMA1_BACTN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gpmA1 PE=3 SV=1 1 180 5.0E-10
sp|B1JSU1|GPMA_YERPY 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gpmA PE=3 SV=1 1 95 5.0E-10
sp|Q66D83|GPMA_YERPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gpmA PE=3 SV=1 1 95 5.0E-10
sp|A4TNS2|GPMA_YERPP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis (strain Pestoides F) GN=gpmA PE=3 SV=1 1 95 5.0E-10
sp|Q1CFN6|GPMA_YERPN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gpmA PE=3 SV=1 1 95 5.0E-10
sp|A9R3B3|GPMA_YERPG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gpmA PE=3 SV=1 1 95 5.0E-10
sp|Q8ZGY5|GPMA_YERPE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis GN=gpmA PE=3 SV=3 1 95 5.0E-10
sp|B2K8R3|GPMA_YERPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gpmA PE=3 SV=1 1 95 5.0E-10
sp|Q1C964|GPMA_YERPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gpmA PE=3 SV=1 1 95 5.0E-10
sp|A7FKP6|GPMA_YERP3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gpmA PE=3 SV=1 1 95 5.0E-10
sp|Q8K9N1|GPMA_BUCAP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=gpmA PE=3 SV=1 4 184 6.0E-10
sp|P15259|PGAM2_HUMAN Phosphoglycerate mutase 2 OS=Homo sapiens GN=PGAM2 PE=1 SV=3 4 170 6.0E-10
sp|Q6MEW4|GPMA_PARUW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Protochlamydia amoebophila (strain UWE25) GN=gpmA PE=3 SV=1 1 184 7.0E-10
sp|O84727|GPMA_CHLTR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gpmA PE=3 SV=1 1 186 7.0E-10
sp|Q3KKX2|GPMA_CHLTA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=gpmA PE=3 SV=1 1 186 7.0E-10
sp|A9M1A2|GPMA_NEIM0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup C (strain 053442) GN=gpmA PE=3 SV=1 2 95 7.0E-10
sp|Q9JYF7|GPMA_NEIMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gpmA PE=3 SV=1 2 95 7.0E-10
sp|B0B8U8|GPMA_CHLT2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=gpmA PE=3 SV=1 1 186 7.0E-10
sp|Q21YW0|GPMA_RHOFT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gpmA PE=3 SV=1 1 180 7.0E-10
sp|A1KV25|GPMA_NEIMF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gpmA PE=3 SV=1 2 95 7.0E-10
sp|P82612|PMGY_CANAL Phosphoglycerate mutase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPM1 PE=1 SV=3 1 96 7.0E-10
sp|B4RIY7|GPMA_NEIG2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gpmA PE=3 SV=1 2 95 7.0E-10
sp|Q5F7C0|GPMA_NEIG1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gpmA PE=3 SV=1 2 95 7.0E-10
sp|Q5L4Y3|GPMA_CHLAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=gpmA PE=3 SV=1 1 186 8.0E-10
sp|Q9JTF2|GPMA_NEIMA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gpmA PE=3 SV=1 2 95 8.0E-10
sp|B4RZM6|GPMA_ALTMD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=gpmA1 PE=3 SV=1 1 180 8.0E-10
sp|B4EST0|GPMA_PROMH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Proteus mirabilis (strain HI4320) GN=gpmA PE=3 SV=1 1 186 1.0E-09
sp|Q88T35|GPMA2_LACPL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gpmA2 PE=3 SV=1 1 95 1.0E-09
sp|Q660L2|GPMA_BORBP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=gpmA PE=3 SV=1 1 95 1.0E-09
sp|A8IGZ9|GPMA_AZOC5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gpmA PE=3 SV=1 4 186 1.0E-09
sp|A8AJ40|GPMA_CITK8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gpmA PE=3 SV=1 1 186 1.0E-09
sp|Q89WK1|GPMA_BRADU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gpmA PE=3 SV=1 4 186 1.0E-09
sp|A1K9B9|GPMA_AZOSB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Azoarcus sp. (strain BH72) GN=gpmA PE=3 SV=1 1 180 1.0E-09
sp|B3QPN8|GPMA_CHLP8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobaculum parvum (strain NCIB 8327) GN=gpmA PE=3 SV=1 1 95 1.0E-09
sp|A6LUA1|GPMA_CLOB8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=gpmA PE=3 SV=1 1 180 2.0E-09
sp|Q3Z455|GPMA_SHISS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella sonnei (strain Ss046) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|P62710|GPMA_SHIFL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella flexneri GN=gpmA PE=3 SV=2 1 186 2.0E-09
sp|Q0T6Y5|GPMA_SHIF8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella flexneri serotype 5b (strain 8401) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|Q324G4|GPMA_SHIBS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|B2TUY6|GPMA_SHIB3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|B7LK04|GPMA_ESCF3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|B1LM46|GPMA_ECOSM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|B6I7Q9|GPMA_ECOSE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain SE11) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|B7N9Z7|GPMA_ECOLU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|P62707|GPMA_ECOLI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12) GN=gpmA PE=1 SV=2 1 186 2.0E-09
sp|B1IXY1|GPMA_ECOLC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|P62708|GPMA_ECOL6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gpmA PE=3 SV=2 1 186 2.0E-09
sp|Q0TJU6|GPMA_ECOL5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|A1A8Z8|GPMA_ECOK1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O1:K1 / APEC GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|A7ZY11|GPMA_ECOHS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O9:H4 (strain HS) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|B1X786|GPMA_ECODH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12 / DH10B) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|C4ZXS6|GPMA_ECOBW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|B7M6B8|GPMA_ECO8A 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O8 (strain IAI1) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|B7MPN9|GPMA_ECO81 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O81 (strain ED1a) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|B7NNH7|GPMA_ECO7I 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|B5YRF2|GPMA_ECO5E 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|P62709|GPMA_ECO57 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O157:H7 GN=gpmA PE=3 SV=2 1 186 2.0E-09
sp|B7LAF6|GPMA_ECO55 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain 55989 / EAEC) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|B7MGL2|GPMA_ECO45 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|B7ULM8|GPMA_ECO27 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|Q32IH0|GPMA_SHIDS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|A4SDM0|GPMA_CHLPM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gpmA PE=3 SV=1 1 95 2.0E-09
sp|A7ZJD0|GPMA_ECO24 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|P00950|PMG1_YEAST Phosphoglycerate mutase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPM1 PE=1 SV=3 1 96 2.0E-09
sp|B1GZZ1|GPMA_UNCTG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gpmA PE=3 SV=1 1 180 2.0E-09
sp|Q3SZ62|PGAM1_BOVIN Phosphoglycerate mutase 1 OS=Bos taurus GN=PGAM1 PE=2 SV=3 4 186 2.0E-09
sp|A7MIX7|GPMA_CROS8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|Q5RFB8|PGAM1_PONAB Phosphoglycerate mutase 1 OS=Pongo abelii GN=PGAM1 PE=2 SV=3 4 186 2.0E-09
sp|B7J2L3|GPMA_BORBZ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia burgdorferi (strain ZS7) GN=gpmA PE=3 SV=1 1 95 2.0E-09
sp|O51602|GPMA_BORBU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=gpmA PE=1 SV=2 1 95 2.0E-09
sp|P18669|PGAM1_HUMAN Phosphoglycerate mutase 1 OS=Homo sapiens GN=PGAM1 PE=1 SV=2 4 186 2.0E-09
sp|Q1LTL3|GPMA_BAUCH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=gpmA PE=3 SV=1 4 190 2.0E-09
sp|A2SDN6|GPMA_METPP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylibium petroleiphilum (strain PM1) GN=gpmA PE=3 SV=1 1 95 2.0E-09
sp|Q821N6|GPMA_CHLCV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydophila caviae (strain GPIC) GN=gpmA PE=3 SV=1 1 186 2.0E-09
sp|B8F5J4|GPMA_HAEPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=gpmA PE=3 SV=1 2 95 2.0E-09
sp|P25113|PGAM1_RAT Phosphoglycerate mutase 1 OS=Rattus norvegicus GN=Pgam1 PE=1 SV=4 4 186 2.0E-09
sp|Q9DBJ1|PGAM1_MOUSE Phosphoglycerate mutase 1 OS=Mus musculus GN=Pgam1 PE=1 SV=3 4 186 2.0E-09
sp|Q2FTH0|GPMA_METHJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=gpmA PE=3 SV=1 1 95 2.0E-09
sp|Q2NUK6|GPMA_SODGM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sodalis glossinidius (strain morsitans) GN=gpmA PE=3 SV=1 1 186 3.0E-09
sp|Q5HLI0|GPMA_STAEQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gpmA PE=3 SV=1 1 186 3.0E-09
sp|Q97FJ6|GPMA_CLOAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gpmA PE=3 SV=1 1 180 3.0E-09
sp|Q11CB5|GPMA_CHESB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chelativorans sp. (strain BNC1) GN=gpmA PE=3 SV=1 3 155 3.0E-09
sp|A8GBA2|GPMA_SERP5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Serratia proteamaculans (strain 568) GN=gpmA PE=3 SV=1 1 183 3.0E-09
sp|P16290|PGAM2_RAT Phosphoglycerate mutase 2 OS=Rattus norvegicus GN=Pgam2 PE=1 SV=2 4 95 4.0E-09
sp|Q21CH5|GPMA_RHOPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodopseudomonas palustris (strain BisB18) GN=gpmA PE=3 SV=1 4 186 4.0E-09
sp|C5BJ25|GPMA_TERTT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|A5UHR1|GPMA_HAEIG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus influenzae (strain PittGG) GN=gpmA PE=3 SV=1 2 95 4.0E-09
sp|Q8ZQS2|GPMA_SALTY 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpmA PE=3 SV=3 1 180 4.0E-09
sp|A9MTL3|GPMA_SALPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|B4TC26|GPMA_SALHS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella heidelberg (strain SL476) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|B5R739|GPMA_SALG2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|B5QX43|GPMA_SALEP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella enteritidis PT4 (strain P125109) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|B5F050|GPMA_SALA4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella agona (strain SL483) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|C1CFM7|GPMA_STRZJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain JJA) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|P0A3Y4|GPMA_STRR6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|P0A3Y3|GPMA_STRPN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|B1I720|GPMA_STRPI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|C1C8P5|GPMA_STRP7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain 70585) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|B5E706|GPMA_STRP4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|Q04JB4|GPMA_STRP2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|A5UDW8|GPMA_HAEIE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus influenzae (strain PittEE) GN=gpmA PE=3 SV=1 2 95 4.0E-09
sp|Q4QME2|GPMA_HAEI8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus influenzae (strain 86-028NP) GN=gpmA PE=3 SV=1 2 95 4.0E-09
sp|A3CLS0|GPMA_STRSV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus sanguinis (strain SK36) GN=gpmA PE=3 SV=1 1 96 4.0E-09
sp|Q8Z8B2|GPMA_SALTI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella typhi GN=gpmA PE=3 SV=3 1 180 4.0E-09
sp|B4TQR7|GPMA_SALSV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella schwarzengrund (strain CVM19633) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|C0PWW0|GPMA_SALPC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi C (strain RKS4594) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|B4SZH5|GPMA_SALNS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella newport (strain SL254) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|Q57RI5|GPMA_SALCH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella choleraesuis (strain SC-B67) GN=gpmA PE=3 SV=1 1 180 4.0E-09
sp|O70250|PGAM2_MOUSE Phosphoglycerate mutase 2 OS=Mus musculus GN=Pgam2 PE=1 SV=3 4 95 5.0E-09
sp|P30798|GPMA_ZYMMO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gpmA PE=1 SV=1 1 186 5.0E-09
sp|C1CSS1|GPMA_STRZT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|C1CLZ5|GPMA_STRZP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain P1031) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|B2IRR1|GPMA_STRPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain CGSP14) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|B8ZM52|GPMA_STRPJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|Q03KA9|GPMA_STRTD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|Q8VVB5|GPMA_STRT2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|Q5LZF1|GPMA_STRT1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=gpmA PE=3 SV=1 1 96 5.0E-09
sp|Q38Z74|GPMA2_LACSS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gpmA2 PE=3 SV=1 1 96 5.0E-09
sp|B5BC52|GPMA_SALPK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi A (strain AKU_12601) GN=gpmA PE=3 SV=1 1 95 5.0E-09
sp|Q5PG75|GPMA_SALPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gpmA PE=3 SV=1 1 95 5.0E-09
sp|B5XM69|GPMA_STRPZ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=gpmA PE=3 SV=1 1 96 6.0E-09
sp|P0DD07|GPMA_STRPQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gpmA PE=3 SV=1 1 96 6.0E-09
sp|Q48SP2|GPMA_STRPM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=gpmA PE=3 SV=1 1 96 6.0E-09
sp|A2RDV4|GPMA_STRPG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=gpmA PE=3 SV=1 1 96 6.0E-09
sp|Q1J5W1|GPMA_STRPF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=gpmA PE=3 SV=1 1 96 6.0E-09
sp|Q1JG44|GPMA_STRPD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=gpmA PE=3 SV=1 1 96 6.0E-09
sp|Q1JL20|GPMA_STRPC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=gpmA PE=3 SV=1 1 96 6.0E-09
sp|Q1JAX0|GPMA_STRPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=gpmA PE=3 SV=1 1 96 6.0E-09
sp|P65711|GPMA_STRP8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gpmA PE=3 SV=1 1 96 6.0E-09
sp|Q5XB88|GPMA_STRP6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gpmA PE=1 SV=1 1 96 6.0E-09
sp|P0DD06|GPMA_STRP3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gpmA PE=3 SV=1 1 96 6.0E-09
sp|Q99Z29|GPMA_STRP1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus pyogenes serotype M1 GN=gpmA PE=3 SV=2 1 96 6.0E-09
sp|B5FP39|GPMA_SALDC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella dublin (strain CT_02021853) GN=gpmA PE=3 SV=1 1 180 6.0E-09
sp|A8AW46|GPMA_STRGC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=gpmA PE=3 SV=1 1 96 6.0E-09
sp|B3QVL0|GPMA_CHLT3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gpmA PE=3 SV=1 1 95 6.0E-09
sp|Q63XU7|GPMA_BURPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia pseudomallei (strain K96243) GN=gpmA PE=3 SV=1 1 180 7.0E-09
sp|A3N5B0|GPMA_BURP6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia pseudomallei (strain 668) GN=gpmA PE=3 SV=1 1 180 7.0E-09
sp|Q3JWH7|GPMA_BURP1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia pseudomallei (strain 1710b) GN=gpmA PE=1 SV=1 1 180 7.0E-09
sp|A3NR09|GPMA_BURP0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia pseudomallei (strain 1106a) GN=gpmA PE=3 SV=1 1 180 7.0E-09
sp|A1UZX9|GPMA_BURMS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia mallei (strain SAVP1) GN=gpmA PE=3 SV=1 1 180 7.0E-09
sp|Q62F43|GPMA_BURMA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia mallei (strain ATCC 23344) GN=gpmA PE=3 SV=1 1 180 7.0E-09
sp|A2S625|GPMA_BURM9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia mallei (strain NCTC 10229) GN=gpmA PE=3 SV=1 1 180 7.0E-09
sp|A3MQ23|GPMA_BURM7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia mallei (strain NCTC 10247) GN=gpmA PE=3 SV=1 1 180 7.0E-09
sp|Q9CIM0|GPMA_LACLA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|Q3B5J2|GPMA_CHLL7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gpmA PE=3 SV=1 1 95 7.0E-09
sp|C1EUQ5|GPMA_BACC3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain 03BB102) GN=gpmA PE=3 SV=1 1 180 7.0E-09
sp|A0RE96|GPMA_BACAH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus thuringiensis (strain Al Hakam) GN=gpmA PE=3 SV=1 1 180 7.0E-09
sp|Q8KFC8|GPMA_CHLTE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gpmA PE=3 SV=1 1 95 8.0E-09
sp|Q82TU0|GPMA2_NITEU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gpmA2 PE=3 SV=1 1 180 8.0E-09
sp|A7GPN5|GPMA_BACCN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gpmA PE=3 SV=1 1 180 8.0E-09
sp|Q63B92|GPMA_BACCZ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain ZK / E33L) GN=gpmA PE=3 SV=1 1 180 9.0E-09
sp|B2S101|GPMA_BORHD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia hermsii (strain HS1 / DAH) GN=gpmA PE=3 SV=1 1 180 9.0E-09
sp|P59161|GPMA_STRMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gpmA PE=3 SV=1 1 96 9.0E-09
sp|B7JPK2|GPMA_BACC0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain AH820) GN=gpmA PE=3 SV=1 1 180 9.0E-09
sp|Q6KSL4|GPMA_BACAN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus anthracis GN=gpmA PE=3 SV=1 1 180 9.0E-09
sp|C3LIE5|GPMA_BACAC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gpmA PE=3 SV=1 1 180 9.0E-09
sp|C3PAW8|GPMA_BACAA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus anthracis (strain A0248) GN=gpmA PE=3 SV=1 1 180 9.0E-09
sp|Q0SMJ5|GPMA_BORAP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia afzelii (strain PKo) GN=gpmA PE=3 SV=1 1 95 1.0E-08
sp|A9IFJ0|GPMA_BORPD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=gpmA PE=3 SV=1 1 95 1.0E-08
sp|B9DUS6|GPMA_STRU0 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=gpmA PE=3 SV=1 1 96 1.0E-08
sp|A7I8A7|GPMA_METB6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanoregula boonei (strain 6A8) GN=gpmA PE=3 SV=1 1 180 1.0E-08
sp|Q7N6S0|GPMA_PHOLL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpmA PE=3 SV=1 1 186 1.0E-08
sp|B2JC95|GPMA_BURP8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=gpmA PE=3 SV=1 1 95 1.0E-08
sp|B7H7P4|GPMA_BACC4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain B4264) GN=gpmA PE=3 SV=1 1 180 1.0E-08
sp|Q4L8T0|GPMA_STAHJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gpmA PE=3 SV=1 1 180 1.0E-08
sp|C5BEL3|GPMA_EDWI9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Edwardsiella ictaluri (strain 93-146) GN=gpmA PE=3 SV=1 1 95 1.0E-08
sp|Q6GE17|GPMA_STAAR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain MRSA252) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|Q031Y3|GPMA_LACLS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=gpmA PE=3 SV=1 1 95 2.0E-08
sp|A2RI67|GPMA_LACLM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gpmA PE=3 SV=1 1 95 2.0E-08
sp|P44865|GPMA_HAEIN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gpmA PE=3 SV=1 2 95 2.0E-08
sp|B3EN99|GPMA_CHLPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium phaeobacteroides (strain BS1) GN=gpmA PE=3 SV=1 1 95 2.0E-08
sp|B9DL85|GPMA_STACT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus carnosus (strain TM300) GN=gpmA PE=3 SV=1 1 177 2.0E-08
sp|B5EC38|GPMA_GEOBB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|P65709|GPMA_STAAW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain MW2) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|A8YYG4|GPMA_STAAT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|Q6G6Q5|GPMA_STAAS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain MSSA476) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|P99153|GPMA_STAAN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain N315) GN=gpmA PE=1 SV=1 1 180 2.0E-08
sp|P65708|GPMA_STAAM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|A6QJQ5|GPMA_STAAE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain Newman) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|Q5HDD9|GPMA_STAAC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain COL) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|Q2YVZ6|GPMA_STAAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|A5IVJ6|GPMA_STAA9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain JH9) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|Q2FVK8|GPMA_STAA8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain NCTC 8325) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|Q2FE81|GPMA_STAA3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain USA300) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|A6U4E6|GPMA_STAA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain JH1) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|A7X656|GPMA_STAA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gpmA PE=3 SV=1 1 180 2.0E-08
sp|B0US27|GPMA_HISS2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Histophilus somni (strain 2336) GN=gpmA PE=3 SV=1 2 95 2.0E-08
sp|Q0I4D8|GPMA_HAES1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus somnus (strain 129Pt) GN=gpmA PE=3 SV=1 2 95 2.0E-08
sp|B2VBS6|GPMA_ERWT9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gpmA PE=3 SV=1 1 186 2.0E-08
sp|Q81DD2|GPMA_BACCR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|Q9CKU9|GPMA_PASMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pasteurella multocida (strain Pm70) GN=gpmA PE=3 SV=1 2 95 3.0E-08
sp|Q0RS35|GPMA_FRAAA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Frankia alni (strain ACN14a) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|Q6HIL9|GPMA_BACHK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|A1R083|GPMA_BORT9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia turicatae (strain 91E135) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|Q8P7A1|GPMA_XANCP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gpmA PE=3 SV=1 4 95 3.0E-08
sp|Q4UWV1|GPMA_XANC8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=gpmA PE=3 SV=1 4 95 3.0E-08
sp|B9J102|GPMA_BACCQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain Q1) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|B7HS46|GPMA_BACC7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain AH187) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|B0RQR7|GPMA_XANCB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas campestris pv. campestris (strain B100) GN=gpmA PE=3 SV=1 4 95 3.0E-08
sp|A4JI45|GPMA_BURVG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|Q2T1H5|GPMA_BURTA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|B1XS92|GPMA_POLNS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=gpmA PE=3 SV=1 1 180 3.0E-08
sp|Q057P1|GPMA_BUCCC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=gpmA PE=3 SV=1 4 95 4.0E-08
sp|C0MCW5|GPMA_STRS7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=gpmA PE=3 SV=1 1 96 4.0E-08
sp|B4U1Y5|GPMA_STREM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=gpmA PE=3 SV=1 1 96 4.0E-08
sp|C0M8R8|GPMA_STRE4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus equi subsp. equi (strain 4047) GN=gpmA PE=3 SV=1 1 96 4.0E-08
sp|A4T096|GPMA_POLSQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=gpmA PE=3 SV=1 1 186 4.0E-08
sp|Q39CN6|GPMA_BURL3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=gpmA PE=3 SV=2 1 180 4.0E-08
sp|B4SEI0|GPMA_PELPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gpmA PE=3 SV=1 1 95 4.0E-08
sp|A9BUZ3|GPMA_DELAS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=gpmA PE=3 SV=1 1 180 5.0E-08
sp|Q4FP74|GPMA_PELUB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pelagibacter ubique (strain HTCC1062) GN=gpmA PE=3 SV=1 1 186 5.0E-08
sp|B0BPB3|GPMA_ACTPJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=gpmA PE=3 SV=1 2 95 5.0E-08
sp|B3H1G9|GPMA_ACTP7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=gpmA PE=3 SV=1 2 95 5.0E-08
sp|A3N0J2|GPMA_ACTP2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=gpmA PE=3 SV=1 2 95 5.0E-08
sp|B4EA64|GPMA_BURCJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=gpmA PE=3 SV=1 1 180 5.0E-08
sp|B1JZ61|GPMA_BURCC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia cenocepacia (strain MC0-3) GN=gpmA PE=3 SV=1 1 180 5.0E-08
sp|Q5FMJ3|GPMA_LACAC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=gpmA PE=3 SV=1 1 95 6.0E-08
sp|Q8D2Y4|GPMA_WIGBR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Wigglesworthia glossinidia brevipalpis GN=gpmA PE=3 SV=1 1 186 6.0E-08
sp|Q74LL9|GPMA1_LACJO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gpmA1 PE=3 SV=1 1 95 6.0E-08
sp|Q929G8|GPMA_LISIN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gpmA PE=3 SV=1 2 191 7.0E-08
sp|Q47KS8|GPMA_THEFY 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Thermobifida fusca (strain YX) GN=gpmA PE=3 SV=1 1 96 7.0E-08
sp|C4K389|GPMA_HAMD5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=gpmA PE=3 SV=1 4 95 7.0E-08
sp|B7IX37|GPMA_BACC2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacillus cereus (strain G9842) GN=gpmA PE=3 SV=1 1 180 7.0E-08
sp|Q32KV0|PGAM2_BOVIN Phosphoglycerate mutase 2 OS=Bos taurus GN=PGAM2 PE=2 SV=1 4 170 8.0E-08
sp|Q7W1Q6|GPMA_BORPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gpmA PE=3 SV=1 1 95 8.0E-08
sp|Q8FSH0|GPMA_COREF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gpmA PE=3 SV=1 4 180 8.0E-08
sp|A1SP05|GPMA_NOCSJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=gpmA PE=3 SV=1 3 180 9.0E-08
sp|B1YNA6|GPMA_BURA4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia ambifaria (strain MC40-6) GN=gpmA PE=3 SV=1 1 180 9.0E-08
sp|Q89AJ4|GPMA_BUCBP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=gpmA PE=3 SV=1 4 180 9.0E-08
sp|B4S616|GPMA_PROA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gpmA PE=3 SV=1 1 95 9.0E-08
sp|Q8E0G9|GPMA_STRA5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=gpmA PE=3 SV=1 1 96 1.0E-07
sp|Q8E643|GPMA_STRA3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gpmA PE=3 SV=1 1 96 1.0E-07
sp|Q3K1U2|GPMA_STRA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=gpmA PE=3 SV=1 1 96 1.0E-07
sp|A4W369|GPMA_STRS2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptococcus suis (strain 98HAH33) GN=gpmA PE=3 SV=1 1 95 1.0E-07
sp|A0AKV8|GPMA_LISW6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gpmA PE=3 SV=1 2 95 1.0E-07
sp|Q0BBK5|GPMA_BURCM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=gpmA PE=3 SV=1 1 180 1.0E-07
sp|B1Y3R5|GPMA_LEPCP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=gpmA PE=3 SV=1 1 95 1.0E-07
sp|B5RQ00|GPMA_BORRA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia recurrentis (strain A1) GN=gpmA PE=3 SV=1 1 95 1.0E-07
sp|Q7VS43|GPMA_BORPE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gpmA PE=3 SV=1 1 180 1.0E-07
sp|Q7WQN2|GPMA_BORBR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gpmA PE=3 SV=1 1 180 1.0E-07
sp|Q2L0A6|GPMA_BORA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bordetella avium (strain 197N) GN=gpmA PE=3 SV=1 1 95 1.0E-07
sp|Q2Y9Z7|GPMA2_NITMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gpmA2 PE=3 SV=1 1 95 1.0E-07
sp|Q5H2V7|GPMA_XANOR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=gpmA PE=3 SV=1 4 95 1.0E-07
sp|Q2P5R0|GPMA_XANOM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=gpmA PE=3 SV=1 4 95 1.0E-07
sp|Q3BR53|GPMA_XANC5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gpmA PE=3 SV=1 4 95 1.0E-07
sp|Q737X5|GPMA1_BACC1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gpmA1 PE=3 SV=1 1 95 1.0E-07
sp|B7KIT8|GPMA_CYAP7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cyanothece sp. (strain PCC 7424) GN=gpmA PE=3 SV=1 1 186 1.0E-07
sp|Q7VL28|GPMA_HAEDU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gpmA PE=3 SV=1 2 95 2.0E-07
sp|B8DFA5|GPMA_LISMH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=gpmA PE=3 SV=1 2 95 2.0E-07
sp|Q71XG0|GPMA_LISMF 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gpmA PE=3 SV=1 2 95 2.0E-07
sp|C1KXG0|GPMA_LISMC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=gpmA PE=3 SV=1 2 95 2.0E-07
sp|Q8Y571|GPMA_LISMO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gpmA PE=3 SV=1 2 95 2.0E-07
sp|Q8PIM1|GPMA_XANAC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gpmA PE=3 SV=1 4 95 2.0E-07
sp|B2SX15|GPMA_BURPP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=gpmA PE=3 SV=1 1 95 2.0E-07
sp|B3EFK8|GPMA_CHLL2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gpmA PE=3 SV=1 1 95 2.0E-07
sp|C5CWV9|GPMA_VARPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Variovorax paradoxus (strain S110) GN=gpmA PE=3 SV=1 1 180 2.0E-07
sp|A6VLV0|GPMA_ACTSZ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=gpmA PE=3 SV=1 2 95 2.0E-07
sp|Q8A765|GPMA2_BACTN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gpmA2 PE=3 SV=1 1 95 2.0E-07
sp|Q65Q32|GPMA_MANSM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=gpmA PE=3 SV=1 2 95 2.0E-07
sp|B0RAW4|GPMA_CLAMS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=gpmA PE=3 SV=1 3 96 2.0E-07
sp|A5CTZ0|GPMA_CLAM3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=gpmA PE=3 SV=1 3 96 2.0E-07
sp|Q3AU60|GPMA_CHLCH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium chlorochromatii (strain CaD3) GN=gpmA PE=3 SV=1 1 95 2.0E-07
sp|Q15SN0|GPMA_PSEA6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gpmA PE=3 SV=1 1 170 2.0E-07
sp|Q0KET8|GPMA_CUPNH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=gpmA PE=3 SV=1 1 180 2.0E-07
sp|B5RMK4|GPMA_BORDL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia duttonii (strain Ly) GN=gpmA PE=3 SV=1 1 95 3.0E-07
sp|B7GUR7|GPMA_BIFLS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=gpmA PE=3 SV=1 4 186 3.0E-07
sp|P59159|GPMA_BIFLO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum (strain NCC 2705) GN=gpmA PE=3 SV=1 4 186 3.0E-07
sp|B3DQI6|GPMA_BIFLD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bifidobacterium longum (strain DJO10A) GN=gpmA PE=3 SV=1 4 186 3.0E-07
sp|B2SRM8|GPMA_XANOP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=gpmA PE=3 SV=1 4 95 3.0E-07
sp|Q476J7|GPMA_CUPPJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=gpmA PE=3 SV=1 1 180 3.0E-07
sp|B4SPL6|GPMA_STRM5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Stenotrophomonas maltophilia (strain R551-3) GN=gpmA PE=3 SV=1 4 95 3.0E-07
sp|B6IYD3|GPMA_RHOCS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=gpmA PE=3 SV=1 1 186 4.0E-07
sp|A1VKR6|GPMA_POLNA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Polaromonas naphthalenivorans (strain CJ2) GN=gpmA PE=3 SV=1 1 180 4.0E-07
sp|F4KI56|SERCL_ARATH Metal-independent phosphoserine phosphatase OS=Arabidopsis thaliana GN=IPSP PE=1 SV=1 4 170 4.0E-07
sp|Q0A915|GPMA_ALKEH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gpmA PE=3 SV=1 1 186 4.0E-07
sp|Q9A634|GPMA_CAUCR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gpmA PE=3 SV=1 1 183 4.0E-07
sp|B8GYN6|GPMA_CAUCN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=gpmA PE=3 SV=1 1 183 4.0E-07
sp|C4LLD4|GPMA_CORK4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=gpmA PE=3 SV=1 4 180 4.0E-07
sp|A5VB15|GPMA_SPHWW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=gpmA PE=3 SV=1 1 191 4.0E-07
sp|Q8R7C8|GPMA_CALS4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gpmA PE=3 SV=1 1 95 4.0E-07
sp|B9MEZ2|GPMA_ACIET 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Acidovorax ebreus (strain TPSY) GN=gpmA PE=3 SV=1 1 180 5.0E-07
sp|A1WDX2|GPMA_VEREI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Verminephrobacter eiseniae (strain EF01-2) GN=gpmA PE=3 SV=1 1 95 5.0E-07
sp|C6E639|GPMA_GEOSM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Geobacter sp. (strain M21) GN=gpmA PE=3 SV=1 1 95 6.0E-07
sp|Q5P7N4|GPMA_AROAE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Aromatoleum aromaticum (strain EbN1) GN=gpmA PE=3 SV=1 1 180 6.0E-07
sp|B8DLN4|GPMA_DESVM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=gpmA PE=3 SV=1 1 186 6.0E-07
sp|P52086|COBC_ECOLI Adenosylcobalamin/alpha-ribazole phosphatase OS=Escherichia coli (strain K12) GN=cobC PE=3 SV=1 2 91 6.0E-07
sp|A1TTW5|GPMA_ACIAC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Acidovorax citrulli (strain AAC00-1) GN=gpmA PE=3 SV=1 1 95 6.0E-07
sp|B8D7J7|GPMA_BUCAT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=gpmA PE=3 SV=1 4 184 7.0E-07
sp|B8D995|GPMA_BUCA5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=gpmA PE=3 SV=1 4 184 7.0E-07
sp|B2FHH6|GPMA_STRMK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Stenotrophomonas maltophilia (strain K279a) GN=gpmA PE=3 SV=1 4 95 7.0E-07
sp|Q6NJL2|GPMA_CORDI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=gpmA PE=3 SV=2 4 180 8.0E-07
sp|Q74CR0|GPMA_GEOSL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gpmA PE=3 SV=1 1 180 9.0E-07
sp|B5Y7Q7|GPMA_COPPD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=gpmA PE=3 SV=1 1 95 9.0E-07
sp|C4XIQ5|GPMA_DESMR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=gpmA PE=3 SV=1 1 180 1.0E-06
sp|Q6MJP3|GPMA_BDEBA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gpmA PE=3 SV=1 1 95 1.0E-06
sp|P57390|GPMA_BUCAI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gpmA PE=3 SV=1 4 184 1.0E-06
sp|B2AGP7|GPMA_CUPTR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=gpmA PE=3 SV=1 1 180 1.0E-06
sp|A1WBJ3|GPMA_ACISJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Acidovorax sp. (strain JS42) GN=gpmA PE=3 SV=1 1 95 2.0E-06
sp|B1VS80|GPMA_STRGG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=gpmA PE=3 SV=1 4 96 2.0E-06
sp|B2KBU4|GPMA_ELUMP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Elusimicrobium minutum (strain Pei191) GN=gpmA PE=3 SV=1 1 186 2.0E-06
sp|Q6ADH3|GPMA_LEIXX 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=gpmA PE=3 SV=1 4 95 2.0E-06
sp|B3DZZ7|GPMA_METI4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylacidiphilum infernorum (isolate V4) GN=gpmA PE=3 SV=1 2 180 2.0E-06
sp|Q01YD0|GPMA_SOLUE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Solibacter usitatus (strain Ellin6076) GN=gpmA PE=3 SV=1 1 95 2.0E-06
sp|Q82XS4|GPMA1_NITEU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gpmA1 PE=3 SV=1 2 154 2.0E-06
sp|Q82GB8|GPMA_STRAW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gpmA PE=3 SV=1 4 96 3.0E-06
sp|A1BE55|GPMA_CHLPD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=gpmA PE=3 SV=1 1 95 3.0E-06
sp|Q5YP50|GPMA_NOCFA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nocardia farcinica (strain IFM 10152) GN=gpmA PE=3 SV=1 3 96 3.0E-06
sp|D3DFP8|PSPB_HYDTT Putative phosphoserine phosphatase 2 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspB PE=1 SV=1 1 100 3.0E-06
sp|B0SY17|GPMA_CAUSK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Caulobacter sp. (strain K31) GN=gpmA PE=3 SV=1 1 181 3.0E-06
sp|Q8NTA5|GPMA_CORGL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gpmA PE=3 SV=1 4 180 3.0E-06
sp|A4QB41|GPMA_CORGB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium glutamicum (strain R) GN=gpmA PE=3 SV=1 4 180 3.0E-06
sp|A5EV29|GPMA_DICNV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Dichelobacter nodosus (strain VCS1703A) GN=gpmA PE=3 SV=1 1 95 3.0E-06
sp|Q3JBA8|GPMA_NITOC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gpmA PE=3 SV=1 4 95 3.0E-06
sp|B0KBW9|GPMA_THEP3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gpmA PE=3 SV=1 1 95 4.0E-06
sp|A0PVZ3|GPMA_MYCUA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Mycobacterium ulcerans (strain Agy99) GN=gpmA PE=3 SV=1 3 95 4.0E-06
sp|B0K4E2|GPMA_THEPX 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Thermoanaerobacter sp. (strain X514) GN=gpmA PE=3 SV=1 1 95 4.0E-06
sp|B2HQV4|GPMA_MYCMM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=gpmA PE=3 SV=1 3 95 5.0E-06
sp|Q7NK82|GPMA1_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA1 PE=3 SV=1 1 186 5.0E-06
sp|B0U2F2|GPMA_XYLFM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xylella fastidiosa (strain M12) GN=gpmA PE=3 SV=1 4 95 5.0E-06
sp|Q9PC88|GPMA_XYLFA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xylella fastidiosa (strain 9a5c) GN=gpmA PE=3 SV=1 4 95 6.0E-06
sp|Q8N0Y7|PGAM4_HUMAN Probable phosphoglycerate mutase 4 OS=Homo sapiens GN=PGAM4 PE=3 SV=1 4 95 6.0E-06
sp|Q4JSW4|GPMA_CORJK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Corynebacterium jeikeium (strain K411) GN=gpmA PE=3 SV=1 3 95 6.0E-06
sp|P33158|GPMA_STRCO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gpmA PE=1 SV=3 4 96 6.0E-06
sp|Q30WZ8|GPMA_DESAG 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Desulfovibrio alaskensis (strain G20) GN=gpmA PE=3 SV=1 1 186 6.0E-06
sp|Q8MKE8|PGAM4_PANTR Probable phosphoglycerate mutase 4 OS=Pan troglodytes GN=PGAM4 PE=3 SV=1 4 91 6.0E-06
sp|C1AZ61|GPMA_RHOOB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodococcus opacus (strain B4) GN=gpmA PE=3 SV=1 3 96 7.0E-06
sp|Q0SF09|GPMA_RHOJR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodococcus jostii (strain RHA1) GN=gpmA PE=3 SV=1 3 96 7.0E-06
sp|Q11SV1|GPMA_CYTH3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=gpmA PE=3 SV=1 1 186 8.0E-06
sp|B8HCQ9|GPMA_ARTCA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=gpmA PE=3 SV=1 4 96 9.0E-06
sp|A0JSU9|GPMA_ARTS2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Arthrobacter sp. (strain FB24) GN=gpmA PE=3 SV=1 4 96 1.0E-05
sp|Q73SU2|GPMA_MYCPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=gpmA PE=3 SV=1 3 95 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|111720
MVTITLIRHGESRDNTKTIWAGWKDAPLSALGERQANAVGTYFHDSSIQFTHIYSSDLSRAHSTALAVLRHHAEP
KPPLVVTPKLREQHFGVAEGQPWTIDVYPGKSIEELSKEGIFPDLTSKGRDLKFPEGESLNDVATRVEEAIKEFI
IPHVFAKDQAAVQIAFASHGICISETISALLRLDPEVEQLKQYKGHHNTGWSQVEISPKADHTGDYDPSSPPPVR
VRLLTFNNYGHLSSLPAPSSENAQARAFFSGSN*
Coding >AgabiH97|111720
ATGGTCACTATTACTCTAATCCGACACGGAGAAAGCAGGGATAACACTAAAACTATCTGGGCGGGCTGGAAAGAT
GCTCCGCTCTCAGCTCTAGGCGAACGCCAAGCAAATGCAGTCGGAACATATTTCCATGATTCTTCCATCCAATTT
ACCCATATATATTCTTCTGATCTGAGTCGTGCACACTCTACCGCCCTCGCTGTACTCCGTCACCACGCGGAGCCC
AAGCCCCCCCTAGTCGTCACTCCGAAATTACGAGAACAGCATTTCGGCGTAGCCGAAGGCCAACCATGGACCATC
GACGTATACCCTGGAAAATCTATAGAAGAATTATCTAAAGAAGGAATATTCCCGGACCTCACATCCAAAGGACGC
GATTTAAAGTTTCCTGAAGGGGAGAGTCTCAATGACGTTGCTACTAGAGTGGAAGAGGCCATCAAGGAATTTATT
ATACCTCACGTTTTTGCCAAGGACCAAGCAGCTGTCCAGATTGCTTTCGCGAGTCATGGCATCTGTATATCAGAG
ACCATATCTGCCTTATTGAGGCTAGATCCAGAGGTCGAGCAGCTTAAACAATACAAAGGCCATCACAACACTGGG
TGGAGTCAAGTAGAAATTTCTCCAAAGGCCGATCATACCGGTGATTATGACCCAAGTTCACCACCCCCCGTTCGA
GTTCGCCTGCTCACATTCAATAATTACGGACACCTTTCTTCCTTGCCTGCCCCTTCGAGTGAGAACGCGCAAGCA
CGTGCATTCTTTTCCGGCAGTAACTAA
Transcript >AgabiH97|111720
ATGGTCACTATTACTCTAATCCGACACGGAGAAAGCAGGGATAACACTAAAACTATCTGGGCGGGCTGGAAAGAT
GCTCCGCTCTCAGCTCTAGGCGAACGCCAAGCAAATGCAGTCGGAACATATTTCCATGATTCTTCCATCCAATTT
ACCCATATATATTCTTCTGATCTGAGTCGTGCACACTCTACCGCCCTCGCTGTACTCCGTCACCACGCGGAGCCC
AAGCCCCCCCTAGTCGTCACTCCGAAATTACGAGAACAGCATTTCGGCGTAGCCGAAGGCCAACCATGGACCATC
GACGTATACCCTGGAAAATCTATAGAAGAATTATCTAAAGAAGGAATATTCCCGGACCTCACATCCAAAGGACGC
GATTTAAAGTTTCCTGAAGGGGAGAGTCTCAATGACGTTGCTACTAGAGTGGAAGAGGCCATCAAGGAATTTATT
ATACCTCACGTTTTTGCCAAGGACCAAGCAGCTGTCCAGATTGCTTTCGCGAGTCATGGCATCTGTATATCAGAG
ACCATATCTGCCTTATTGAGGCTAGATCCAGAGGTCGAGCAGCTTAAACAATACAAAGGCCATCACAACACTGGG
TGGAGTCAAGTAGAAATTTCTCCAAAGGCCGATCATACCGGTGATTATGACCCAAGTTCACCACCCCCCGTTCGA
GTTCGCCTGCTCACATTCAATAATTACGGACACCTTTCTTCCTTGCCTGCCCCTTCGAGTGAGAACGCGCAAGCA
CGTGCATTCTTTTCCGGCAGTAACTAA
Gene >AgabiH97|111720
ATGGTCACTATTACTCTAGTGAGTTGCAACTTATCTACTGCAAGCCGATCATTGTTCACCATTCTCTAGATCCGA
CACGGAGAAAGCAGGGATAACACTGTGGGTCCTTCCGTATGATCCGTCCAATAATAAACCGACTTTAGATAGAAA
ACTATCTGGGCGGGCTGGAAAGATGCTCCGCTCTCAGCTCTAGGCGAACGCGTAAGCCAGAAATCATCGCCTTGA
CTTCCACACCGTTAACCCAAAAATTCCAGCAAGCAAATGCAGTCGGAACATATTTCCATGATTCTTCCATCCAAT
TTACCCATATATATTCTTCTGATCTGAGTCGTGCACACTCTACCGCCCTCGCTGTACTCCGTCACCACGCGGAGC
CCAAGCCCCCCCTAGTCGTCACTCCGAAATTACGAGAACAGCATTTCGGCGTAGCCGAAGGCCAACCATGGACCA
TCGACGTATACCCTGGAAAATCTATAGAAGAATTATCTAAAGAAGGAATATTCCCGGACCTCACATCCAAAGGAC
GCGATTTAAAGTTTCCTGAAGGGGAGAGTCTCAATGACGTTGCTACTAGAGTGGAAGAGGCCATCAAGGAATTTA
TTATACCTCACGTTTTTGCCAAGGACCAAGCAGCTGTCCAGATTGCTTTCGCGAGTCATGGCATCTGTATATCAG
AGACCATATCTGCCTTATTGAGGCTAGATCCAGAGGTCGAGCAGCTTAAACAATACAAAGGCCATCACAACACTG
GGTGGAGTCAAGTAGAAATTTCTCCAAAGGTATATCGCAATCCATTATCGTCTCGTAAATTGACGAATACTGACT
GACATCACATATACTTAGGCCGATCATACCGGTGATTATGACCCAAGTTCACCACCCCCCGTTCGAGTTCGCCTG
CTCACATTCAATAATTACGGACACCTTTCTTCCTTGGTATGTACATGGCAGTTATCTTCACCATCAAGTCATTTG
ACACCTGCTTACCAGCCTGCCCCTTCGAGTGAGAACGCGCAAGCACGTGCATTCTTTTCCGGCAGTAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail