Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|111550
Gene name
Locationscaffold_8:1419858..1421132
Strand-
Gene length (bp)1274
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08498 Sterol_MT_C Sterol methyltransferase C-terminal 7.8E-30 281 345
PF13847 Methyltransf_31 Methyltransferase domain 9.3E-19 94 207
PF08241 Methyltransf_11 Methyltransferase domain 9.2E-18 99 197
PF13649 Methyltransf_25 Methyltransferase domain 7.7E-16 98 195
PF13489 Methyltransf_23 Methyltransferase domain 1.8E-14 87 250
PF02353 CMAS Mycolic acid cyclopropane synthetase 5.1E-13 46 254
PF08242 Methyltransf_12 Methyltransferase domain 1.9E-10 99 197
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 4.8E-08 86 202
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 8.1E-07 86 179
PF09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase 3.9E-05 97 169

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14321|ERG6_SCHPO Sterol 24-C-methyltransferase erg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg6 PE=2 SV=1 14 345 6.0E-135
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 15 347 6.0E-128
sp|O74198|ERG6_CANAL Sterol 24-C-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG6 PE=3 SV=1 16 345 3.0E-127
sp|Q6BRB7|ERG6_DEBHA Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 32 347 2.0E-126
sp|Q6FRZ7|ERG6_CANGA Sterol 24-C-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG6 PE=3 SV=1 15 347 1.0E-125
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14321|ERG6_SCHPO Sterol 24-C-methyltransferase erg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg6 PE=2 SV=1 14 345 6.0E-135
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 15 347 6.0E-128
sp|O74198|ERG6_CANAL Sterol 24-C-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG6 PE=3 SV=1 16 345 3.0E-127
sp|Q6BRB7|ERG6_DEBHA Sterol 24-C-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERG6 PE=3 SV=1 32 347 2.0E-126
sp|Q6FRZ7|ERG6_CANGA Sterol 24-C-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG6 PE=3 SV=1 15 347 1.0E-125
sp|P25087|ERG6_YEAST Sterol 24-C-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG6 PE=1 SV=4 15 347 7.0E-124
sp|Q875K1|ERG6_CLAL4 Sterol 24-C-methyltransferase OS=Clavispora lusitaniae (strain ATCC 42720) GN=ERG6 PE=3 SV=1 32 345 9.0E-124
sp|Q6CYB3|ERG6_KLULA Sterol 24-C-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERG6 PE=3 SV=1 15 345 2.0E-122
sp|Q759S7|ERG6_ASHGO Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 12 345 5.0E-122
sp|Q9P3R1|ERG6_NEUCR Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 16 347 2.0E-119
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 15 345 3.0E-116
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 15 345 1.0E-103
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 15 345 1.0E-103
sp|Q9LM02|SMT1_ARATH Cycloartenol-C-24-methyltransferase OS=Arabidopsis thaliana GN=SMT1 PE=1 SV=1 33 345 9.0E-103
sp|Q6ZIX2|SMT1_ORYSJ Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 35 345 4.0E-101
sp|Q54I98|SMT1_DICDI Probable cycloartenol-C-24-methyltransferase 1 OS=Dictyostelium discoideum GN=smt1 PE=1 SV=1 5 345 5.0E-89
sp|O82427|SMT2_ORYSJ 24-methylenesterol C-methyltransferase 2 OS=Oryza sativa subsp. japonica GN=Smt2-1 PE=2 SV=2 16 345 1.0E-76
sp|Q39227|SMT2_ARATH 24-methylenesterol C-methyltransferase 2 OS=Arabidopsis thaliana GN=SMT2 PE=1 SV=2 16 347 4.0E-76
sp|H2E7T7|BOMT_BOTBR Botryococcene C-methyltransferase OS=Botryococcus braunii GN=TMT-3 PE=1 SV=1 28 345 3.0E-73
sp|Q94JS4|SMT3B_ARATH 24-methylenesterol C-methyltransferase 3 OS=Arabidopsis thaliana GN=SMT3 PE=2 SV=1 16 345 4.0E-72
sp|H2E7T5|SQMT1_BOTBR Squalene methyltransferase 1 OS=Botryococcus braunii GN=TMT-1 PE=1 SV=1 10 346 6.0E-68
sp|H2E7T6|SQMT2_BOTBR Squalene methyltransferase 2 OS=Botryococcus braunii GN=TMT-2 PE=1 SV=1 16 345 3.0E-66
sp|H2E7T9|SMTL2_BOTBR Sterol methyltransferase-like 2 OS=Botryococcus braunii GN=SMT-2 PE=2 SV=1 44 345 1.0E-63
sp|H2E7T8|SMTL1_BOTBR Sterol methyltransferase-like 1 OS=Botryococcus braunii GN=SMT-1 PE=2 SV=1 44 345 3.0E-59
sp|H2E7U0|SMTL3_BOTBR Sterol methyltransferase-like 3 OS=Botryococcus braunii GN=SMT-3 PE=2 SV=1 11 345 3.0E-57
sp|Q9TYP1|STRM1_CAEEL Sterol 4-C-methyltransferase strm-1 OS=Caenorhabditis elegans GN=strm-1 PE=3 SV=2 25 346 7.0E-25
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 45 204 2.0E-18
sp|P74388|BQMT_SYNY3 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0418 PE=1 SV=1 42 207 6.0E-15
sp|Q6ZIK0|GTOMC_ORYSJ Probable tocopherol O-methyltransferase, chloroplastic OS=Oryza sativa subsp. japonica GN=VTE4 PE=2 SV=1 45 203 2.0E-13
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 90 257 5.0E-12
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 88 257 1.0E-11
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 90 246 8.0E-11
sp|Q9ZSK1|GTOMC_ARATH Tocopherol O-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=VTE4 PE=1 SV=2 98 203 2.0E-10
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 90 205 2.0E-10
sp|Q9KJ20|GSDMT_ACTHA Glycine/sarcosine/dimethylglycine N-methyltransferase OS=Actinopolyspora halophila PE=1 SV=1 86 247 4.0E-10
sp|Q83WC3|SDMT_APHHA Sarcosine/dimethylglycine N-methyltransferase OS=Aphanothece halophytica PE=1 SV=1 95 206 5.0E-10
sp|Q9KJ21|SDMT_HALHR Sarcosine/dimethylglycine N-methyltransferase OS=Halorhodospira halochloris PE=1 SV=1 76 265 8.0E-10
sp|Q7U4Z9|SDMT_SYNPX Dimethylglycine N-methyltransferase OS=Synechococcus sp. (strain WH8102) GN=bsmB PE=1 SV=1 44 197 3.0E-09
sp|Q9RMN9|MTF2_MYCS2 Fatty-acid O-methyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mtf2 PE=3 SV=1 95 197 4.0E-09
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 43 254 4.0E-08
sp|A4F7P5|ERYG_SACEN Erythromycin 3''-O-methyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryG PE=1 SV=1 95 229 4.0E-08
sp|P9WIN3|PHMT_MYCTU Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2952 PE=1 SV=1 95 257 1.0E-07
sp|P9WIN2|PHMT_MYCTO Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3026 PE=3 SV=1 95 257 1.0E-07
sp|A5U6W0|PHMT_MYCTA Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_2979 PE=3 SV=1 95 257 1.0E-07
sp|A1KMU6|PHMT_MYCBP Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_2973 PE=3 SV=1 95 257 1.0E-07
sp|Q7TXK3|PHMT_MYCBO Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2976 PE=3 SV=1 95 257 1.0E-07
sp|Q8FUZ3|UBIE_BRUSU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella suis biovar 1 (strain 1330) GN=ubiE PE=3 SV=1 93 203 1.0E-07
sp|A9MCZ2|UBIE_BRUC2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ubiE PE=3 SV=1 93 203 1.0E-07
sp|Q9CD86|PHMT_MYCLE Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase OS=Mycobacterium leprae (strain TN) GN=ML0130 PE=3 SV=1 95 257 4.0E-07
sp|Q4ZZG3|UBIE_PSEU2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiE PE=3 SV=1 92 210 5.0E-07
sp|Q48PJ4|UBIE_PSE14 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiE PE=3 SV=1 92 210 5.0E-07
sp|Q87UZ2|UBIE_PSESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiE PE=3 SV=1 92 210 5.0E-07
sp|Q6NDM2|UBIE_RHOPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ubiE PE=3 SV=1 97 206 7.0E-07
sp|B3Q619|UBIE_RHOPT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhodopseudomonas palustris (strain TIE-1) GN=ubiE PE=3 SV=1 97 206 7.0E-07
sp|Q98GV1|UBIE_RHILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Rhizobium loti (strain MAFF303099) GN=ubiE PE=3 SV=1 93 203 7.0E-07
sp|Q6GGU0|MENG_STAAR Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 90 201 1.0E-06
sp|P64842|Y1440_MYCBO Uncharacterized protein Mb1440c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1440c PE=3 SV=1 86 202 2.0E-06
sp|P9WLY7|Y1405_MYCTU Uncharacterized protein Rv1405c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1405c PE=1 SV=1 86 202 2.0E-06
sp|P9WLY6|Y1405_MYCTO Uncharacterized protein MT1449 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1449 PE=3 SV=1 86 202 2.0E-06
sp|A6WYI0|UBIE_OCHA4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ubiE PE=3 SV=1 93 203 2.0E-06
sp|A0PQX0|PHMT1_MYCUA Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 1 OS=Mycobacterium ulcerans (strain Agy99) GN=MUL_2377 PE=3 SV=1 84 195 3.0E-06
sp|Q47GP8|UBIG_DECAR Ubiquinone biosynthesis O-methyltransferase OS=Dechloromonas aromatica (strain RCB) GN=ubiG PE=3 SV=1 95 195 3.0E-06
sp|Q74LY0|MENG_LACJO Demethylmenaquinone methyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=menG PE=3 SV=1 99 201 3.0E-06
sp|Q1QEI9|UBIG_PSYCK Ubiquinone biosynthesis O-methyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=ubiG PE=3 SV=2 95 196 3.0E-06
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 90 200 3.0E-06
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 90 200 3.0E-06
sp|Q55423|Y829_SYNY3 Uncharacterized methyltransferase sll0829 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0829 PE=3 SV=1 90 208 4.0E-06
sp|Q8CSH9|MENG_STAES Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menG PE=3 SV=1 74 201 4.0E-06
sp|Q5HP74|MENG_STAEQ Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menG PE=3 SV=1 74 201 4.0E-06
sp|Q2YY85|MENG_STAAB Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 90 201 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0009452 7-methylguanosine RNA capping Yes
GO:0001510 RNA methylation Yes
GO:0006694 steroid biosynthetic process Yes
GO:0043170 macromolecule metabolic process No
GO:0032259 methylation No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0008202 steroid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006396 RNA processing No
GO:0009058 biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0006629 lipid metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0008610 lipid biosynthetic process No
GO:0009987 cellular process No
GO:0043414 macromolecule methylation No
GO:0044238 primary metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003674 molecular_function No
GO:0036260 RNA capping No
GO:0016740 transferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0009451 RNA modification No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|111550
MVVNARTDGRVEGRIENYTKFWKENPNSEENEDNERRLNSYTDVVNGYYDGATQLYEFGWSRSFHFSRFYKGEAF
DASLVRHEHYLSAYMQLRPGMRVLDVGCGVGGPARQIATFTGSDIVGVNNNAFQVGRARKYTQKMGLQDQVQFVK
GDFMKLVEQFGENSFDAVYAIEATCHAPTWEGVYGEIFKVLKPGGVFGVYEWCMTDEWDASNPEHKALAHQIELG
NGIPEMRPLRQAREALKNVGFEIEHEEDLADRPDEVPWYYPLEGDISKAQTLWDYLTVWRMSWSGKLVSHNAIRV
MEWFGVLPKGTYDVSESLKVAADALVKGGQAKLFTPMYLVVSRKPRN*
Coding >AgabiH97|111550
ATGGTTGTCAACGCTCGTACTGATGGTCGTGTCGAGGGTCGTATTGAGAATTATACCAAATTTTGGAAGGAGAAT
CCTAATTCTGAAGAGAATGAGGATAATGAGAGGAGGTTGAACAGTTATACTGATGTCGTCAACGGTTACTATGAT
GGCGCGACACAACTATATGAATTTGGTTGGAGTCGATCCTTCCATTTCTCTCGTTTTTACAAAGGCGAAGCTTTT
GACGCGTCACTTGTTCGTCATGAACATTATCTCTCAGCGTATATGCAACTTCGTCCGGGGATGAGAGTCCTTGAT
GTTGGTTGTGGTGTTGGTGGACCTGCACGACAAATTGCTACATTTACTGGCTCGGATATTGTTGGTGTGAATAAC
AATGCATTCCAAGTTGGTCGTGCGAGGAAGTATACGCAGAAGATGGGATTGCAGGACCAGGTTCAGTTTGTTAAA
GGCGACTTTATGAAGCTTGTTGAACAGTTTGGAGAGAATTCTTTTGATGCTGTGTATGCTATCGAGGCGACCTGT
CATGCTCCTACTTGGGAAGGTGTTTACGGTGAAATCTTCAAGGTGCTCAAGCCAGGAGGGGTCTTTGGTGTCTAC
GAATGGTGTATGACTGATGAATGGGATGCATCCAATCCTGAACACAAAGCCCTCGCTCACCAAATTGAGTTGGGT
AATGGTATTCCCGAGATGCGACCCCTCCGTCAAGCGCGTGAGGCATTGAAAAATGTTGGATTCGAGATTGAGCAC
GAGGAGGATTTGGCTGACCGTCCGGACGAGGTTCCGTGGTATTACCCTTTGGAGGGTGATATCTCGAAGGCGCAG
ACGTTGTGGGATTACTTGACTGTATGGCGAATGAGCTGGAGCGGGAAATTGGTTAGCCATAATGCGATCCGAGTG
ATGGAGTGGTTTGGGGTGTTGCCAAAGGGCACATACGATGTGAGCGAGTCGCTCAAGGTTGCAGCGGATGCGTTG
GTGAAGGGCGGACAGGCCAAGCTGTTCACTCCGATGTATCTGGTTGTCAGCCGGAAACCCAGGAATTGA
Transcript >AgabiH97|111550
ATGGTTGTCAACGCTCGTACTGATGGTCGTGTCGAGGGTCGTATTGAGAATTATACCAAATTTTGGAAGGAGAAT
CCTAATTCTGAAGAGAATGAGGATAATGAGAGGAGGTTGAACAGTTATACTGATGTCGTCAACGGTTACTATGAT
GGCGCGACACAACTATATGAATTTGGTTGGAGTCGATCCTTCCATTTCTCTCGTTTTTACAAAGGCGAAGCTTTT
GACGCGTCACTTGTTCGTCATGAACATTATCTCTCAGCGTATATGCAACTTCGTCCGGGGATGAGAGTCCTTGAT
GTTGGTTGTGGTGTTGGTGGACCTGCACGACAAATTGCTACATTTACTGGCTCGGATATTGTTGGTGTGAATAAC
AATGCATTCCAAGTTGGTCGTGCGAGGAAGTATACGCAGAAGATGGGATTGCAGGACCAGGTTCAGTTTGTTAAA
GGCGACTTTATGAAGCTTGTTGAACAGTTTGGAGAGAATTCTTTTGATGCTGTGTATGCTATCGAGGCGACCTGT
CATGCTCCTACTTGGGAAGGTGTTTACGGTGAAATCTTCAAGGTGCTCAAGCCAGGAGGGGTCTTTGGTGTCTAC
GAATGGTGTATGACTGATGAATGGGATGCATCCAATCCTGAACACAAAGCCCTCGCTCACCAAATTGAGTTGGGT
AATGGTATTCCCGAGATGCGACCCCTCCGTCAAGCGCGTGAGGCATTGAAAAATGTTGGATTCGAGATTGAGCAC
GAGGAGGATTTGGCTGACCGTCCGGACGAGGTTCCGTGGTATTACCCTTTGGAGGGTGATATCTCGAAGGCGCAG
ACGTTGTGGGATTACTTGACTGTATGGCGAATGAGCTGGAGCGGGAAATTGGTTAGCCATAATGCGATCCGAGTG
ATGGAGTGGTTTGGGGTGTTGCCAAAGGGCACATACGATGTGAGCGAGTCGCTCAAGGTTGCAGCGGATGCGTTG
GTGAAGGGCGGACAGGCCAAGCTGTTCACTCCGATGTATCTGGTTGTCAGCCGGAAACCCAGGAATTGA
Gene >AgabiH97|111550
ATGGTTGTCAACGCTCGTACTGATGGTCGTGTCGAGGGTCGTATTGAGAATTATACCAAATTTTGGAAGGAGAAT
CCTAATTCTGAAGAGAATGAGGATAATGAGAGGAGGTTGAACAGTTATACTGATGTCGTCAACGGTTAGTTCCAT
TCAATTTGAAACGACAATTGAATTCAAATGAACTGTTTTTTCTTCTTAGGTTACTATGATGGCGCGACACAACTA
TATGAATTTGGTTGGAGTCGATCCTTCCATTTCTCTCGTTTTTACAAAGGCGAAGCTTTTGACGCGTCACTTGTT
CGTCATGAACATTATCTCTCAGCGTATATGCAACTTCGTCCGGGGATGAGAGTCCTTGATGTTGGTTGTGGTGTT
GGTGGACCTGCACGACAAATTGCTACATTTACTGGCTCGGATATTGTTGGTGTGAATAACAATGCATTCCAAGTT
GGTCGTGCGAGGAAGTATACGCAGAAGATGGGATTGCAGGACCAGGTTCAGTTTGTTAAAGGCGACTTTATGAAG
CTTGTTGAACAGTTTGGAGAGAATTCTTTTGATGCTGGTAATTGCTTTTTCTTTTTTTCTGTTTTATATGGTGGA
CTGACAAGGCTCTATAGTGTATGCTATCGAGGCGACCTGTCATGCTCCTACTTGGGAAGGTGTTTACGGTGAAAT
CTTCAAGGTGCTCAAGCCAGGAGGGGTCGTAAGTGACTTGGCTGTGTTCCCGTAGTTCTGGTCTAATGTTGGTGA
CACGTAGTTTGGTGTCTACGAATGGTGTATGACTGATGAATGGGATGCATCCAATCCTGAACACAAAGCCCTCGC
TCACCAAATTGAGTTGGGTAATGGTATTCCCGAGATGCGACCCCTCCGTCAAGCGCGTGAGGCATTGAAAAATGT
TGGATTCGAGATTGAGCACGAGGAGGATTTGGCTGACCGTCCGGACGAGGTTCCGTGGTATTACCCTTTGGAGGG
TGATATCTCGAAGGCGCAGACGTTGTGGGATTACTTGACTGTATGGCGAATGAGCTGGAGCGGGAAATTGGTTAG
CCATAATGCGATCCGAGTGATGGAGTGGTTTGGGGTGTTGCCAAAGGGCACATACGATGTGAGCGAGTCGCTCAA
GGTTGCAGCGGATGCGTTGGTGAAGGGCGGACAGGCCAAGGTAAGGATTTTTTTCTGGTGTTTGTTGCTGAGAAT
CCGAGAGCTGATGCGAATTTGGGTAGCTGTTCACTCCGATGTATCTGGTTGTCAGCCGGAAACCCAGGAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail