Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|111530
Gene name
Locationscaffold_8:1415132..1417690
Strand+
Gene length (bp)2558
Transcript length (bp)2319
Coding sequence length (bp)2319
Protein length (aa) 773

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00326 Peptidase_S9 Prolyl oligopeptidase family 9.4E-35 556 770
PF07676 PD40 WD40-like Beta Propeller Repeat 1.6E-07 86 122
PF07676 PD40 WD40-like Beta Propeller Repeat 3.2E-02 177 188
PF20434 BD-FAE BD-FAE 3.9E-08 520 725

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39839|YUXL_BACSU Uncharacterized peptidase YuxL OS=Bacillus subtilis (strain 168) GN=yuxL PE=3 SV=3 498 764 4.0E-20
sp|P13676|ACPH_RAT Acylamino-acid-releasing enzyme OS=Rattus norvegicus GN=Apeh PE=1 SV=1 522 772 8.0E-17
sp|P13798|ACPH_HUMAN Acylamino-acid-releasing enzyme OS=Homo sapiens GN=APEH PE=1 SV=4 505 772 2.0E-16
sp|P80227|ACPH_BOVIN Acylamino-acid-releasing enzyme OS=Bos taurus GN=APEH PE=1 SV=2 522 772 2.0E-15
sp|P19205|ACPH_PIG Acylamino-acid-releasing enzyme OS=Sus scrofa GN=APEH PE=1 SV=2 528 772 3.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39839|YUXL_BACSU Uncharacterized peptidase YuxL OS=Bacillus subtilis (strain 168) GN=yuxL PE=3 SV=3 498 764 4.0E-20
sp|P13676|ACPH_RAT Acylamino-acid-releasing enzyme OS=Rattus norvegicus GN=Apeh PE=1 SV=1 522 772 8.0E-17
sp|P13798|ACPH_HUMAN Acylamino-acid-releasing enzyme OS=Homo sapiens GN=APEH PE=1 SV=4 505 772 2.0E-16
sp|P80227|ACPH_BOVIN Acylamino-acid-releasing enzyme OS=Bos taurus GN=APEH PE=1 SV=2 522 772 2.0E-15
sp|P19205|ACPH_PIG Acylamino-acid-releasing enzyme OS=Sus scrofa GN=APEH PE=1 SV=2 528 772 3.0E-15
sp|Q8R146|APEH_MOUSE Acylamino-acid-releasing enzyme OS=Mus musculus GN=Apeh PE=1 SV=3 528 772 5.0E-15
sp|Q8BVG4|DPP9_MOUSE Dipeptidyl peptidase 9 OS=Mus musculus GN=Dpp9 PE=1 SV=2 498 768 4.0E-13
sp|V5YMB3|DAPB3_PSEMX Dipeptidyl aminopeptidase BIII OS=Pseudoxanthomonas mexicana GN=dapb3 PE=1 SV=1 474 752 2.0E-12
sp|Q86TI2|DPP9_HUMAN Dipeptidyl peptidase 9 OS=Homo sapiens GN=DPP9 PE=1 SV=3 498 768 3.0E-12
sp|Q8VZF3|CGEP_ARATH Probable glutamyl endopeptidase, chloroplastic OS=Arabidopsis thaliana GN=GEP PE=2 SV=2 478 761 6.0E-12
sp|Q6V1X1|DPP8_HUMAN Dipeptidyl peptidase 8 OS=Homo sapiens GN=DPP8 PE=1 SV=1 498 749 7.0E-12
sp|Q80YA7|DPP8_MOUSE Dipeptidyl peptidase 8 OS=Mus musculus GN=Dpp8 PE=1 SV=1 498 749 2.0E-11
sp|Q9YBQ2|APEH_AERPE Acylamino-acid-releasing enzyme OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=APE_1547.1 PE=1 SV=1 530 717 1.0E-10
sp|Q6F3I7|DAP4_PSEMX Dipeptidyl aminopeptidase 4 OS=Pseudoxanthomonas mexicana GN=dap4 PE=1 SV=1 517 751 2.0E-10
sp|B2RJX3|PTP_PORG3 Prolyl tripeptidyl peptidase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=ptpA PE=3 SV=1 525 649 7.0E-10
sp|Q7MUW6|PTP_PORGI Prolyl tripeptidyl peptidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=ptpA PE=1 SV=1 525 649 8.0E-10
sp|Q10MJ1|CGEP_ORYSJ Probable glutamyl endopeptidase, chloroplastic OS=Oryza sativa subsp. japonica GN=GEP PE=2 SV=1 495 761 1.0E-09
sp|P34422|DPF6_CAEEL Dipeptidyl peptidase family member 6 OS=Caenorhabditis elegans GN=dpf-6 PE=3 SV=2 519 763 1.0E-08
sp|A6RBI0|DAPB_AJECN Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DAPB PE=3 SV=1 479 715 1.0E-08
sp|C0NUQ8|DAPB_AJECG Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=DAPB PE=3 SV=1 479 715 2.0E-08
sp|C6HRC7|DAPB_AJECH Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain H143) GN=DAPB PE=3 SV=1 479 715 2.0E-08
sp|F0U7H7|DAPB_AJEC8 Probable dipeptidyl-aminopeptidase B OS=Ajellomyces capsulatus (strain H88) GN=DAPB PE=3 SV=1 479 715 2.0E-08
sp|B0XYK8|DAPB_ASPFC Probable dipeptidyl-aminopeptidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=dapB PE=3 SV=1 485 649 2.0E-08
sp|Q4WX13|DAPB_ASPFU Probable dipeptidyl-aminopeptidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dapB PE=3 SV=2 485 649 2.0E-08
sp|A0S5V9|DPP4_ARTOT Dipeptidyl peptidase 4 OS=Arthroderma otae GN=DPP4 PE=3 SV=1 380 627 2.0E-08
sp|C5FJE3|DPP4_ARTOC Dipeptidyl peptidase 4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=DPP4 PE=3 SV=2 380 627 2.0E-08
sp|D4CZ59|DPP4_TRIVH Probable dipeptidyl peptidase 4 OS=Trichophyton verrucosum (strain HKI 0517) GN=DPP4 PE=3 SV=1 401 683 5.0E-08
sp|D4APE2|DPP4_ARTBC Probable dipeptidyl peptidase 4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=DPP4 PE=1 SV=1 380 627 6.0E-08
sp|A1D7R6|DAPB_NEOFI Probable dipeptidyl-aminopeptidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dapB PE=3 SV=1 485 649 7.0E-08
sp|C5JC30|DAPB_AJEDS Probable dipeptidyl-aminopeptidase B OS=Ajellomyces dermatitidis (strain SLH14081) GN=DAPB PE=3 SV=1 479 720 7.0E-08
sp|C5GVF3|DAPB_AJEDR Probable dipeptidyl-aminopeptidase B OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=DAPB PE=3 SV=1 479 720 7.0E-08
sp|P97321|SEPR_MOUSE Prolyl endopeptidase FAP OS=Mus musculus GN=Fap PE=1 SV=1 496 650 1.0E-07
sp|B6HFS8|DAPB_PENRW Probable dipeptidyl-aminopeptidase B OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=dapB PE=3 SV=1 478 717 1.0E-07
sp|C5FYZ3|DAPB_ARTOC Probable dipeptidyl-aminopeptidase B OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=DAPB PE=3 SV=1 476 764 2.0E-07
sp|A7UKV8|DPP4_TRIEQ Dipeptidyl peptidase 4 OS=Trichophyton equinum GN=DPP4 PE=3 SV=1 380 627 2.0E-07
sp|Q7SHU8|DAPB_NEUCR Probable dipeptidyl-aminopeptidase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dapB PE=3 SV=2 489 751 2.0E-07
sp|Q2UH35|DPP4_ASPOR Dipeptidyl peptidase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dpp4 PE=1 SV=1 507 720 2.0E-07
sp|B8N970|DPP4_ASPFN Probable dipeptidyl peptidase 4 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dpp4 PE=3 SV=1 507 720 2.0E-07
sp|A1CJQ1|DAPB_ASPCL Probable dipeptidyl-aminopeptidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dapB PE=3 SV=1 489 626 2.0E-07
sp|B2A951|DAPB_PODAN Probable dipeptidyl-aminopeptidase B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=DAPB PE=3 SV=1 506 751 3.0E-07
sp|Q0UVK7|DAPB_PHANO Probable dipeptidyl-aminopeptidase B OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DAPB PE=3 SV=1 491 749 4.0E-07
sp|D4DCG0|DAPB_TRIVH Probable dipeptidyl-aminopeptidase B OS=Trichophyton verrucosum (strain HKI 0517) GN=DAPB PE=3 SV=1 476 763 4.0E-07
sp|Q5J6J3|DPP4_TRIRU Dipeptidyl peptidase 4 OS=Trichophyton rubrum GN=DPP4 PE=1 SV=1 380 627 6.0E-07
sp|D4AQT0|DAPB_ARTBC Probable dipeptidyl-aminopeptidase B OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=DAPB PE=3 SV=1 476 763 7.0E-07
sp|A5D7B7|SEPR_BOVIN Prolyl endopeptidase FAP OS=Bos taurus GN=FAP PE=1 SV=1 496 650 8.0E-07
sp|B0XRV0|DPP5_ASPFC Dipeptidyl-peptidase 5 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_024920 PE=1 SV=1 509 771 8.0E-07
sp|P0C959|DPP5_ASPFU Dipeptidyl-peptidase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G09030 PE=2 SV=1 509 771 9.0E-07
sp|B6V868|DPP4_TRITO Dipeptidyl peptidase 4 OS=Trichophyton tonsurans GN=DPP4 PE=3 SV=1 380 627 9.0E-07
sp|Q12884|SEPR_HUMAN Prolyl endopeptidase FAP OS=Homo sapiens GN=FAP PE=1 SV=5 494 650 1.0E-06
sp|B8N076|DAPB_ASPFN Probable dipeptidyl-aminopeptidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=dapB PE=3 SV=1 489 727 1.0E-06
sp|Q5AZ42|DPP4_EMENI Probable dipeptidyl peptidase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dpp4 PE=3 SV=1 507 715 1.0E-06
sp|Q5B934|DAPB_EMENI Probable dipeptidyl-aminopeptidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dapB PE=3 SV=2 486 715 1.0E-06
sp|Q2UPW4|DAPB_ASPOR Probable dipeptidyl-aminopeptidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dapB PE=3 SV=1 489 727 2.0E-06
sp|E4UYL6|DAPB_ARTGP Probable dipeptidyl-aminopeptidase B OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=DAPB PE=3 SV=1 476 764 2.0E-06
sp|C7YYG9|DAPB_NECH7 Probable dipeptidyl-aminopeptidase B OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=DAPB PE=3 SV=1 482 649 2.0E-06
sp|B6QVW4|DAPB_TALMQ Probable dipeptidyl-aminopeptidase B OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=dapB PE=3 SV=1 479 764 3.0E-06
sp|B8MTH6|DAPB_TALSN Probable dipeptidyl-aminopeptidase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=dapB PE=3 SV=1 479 764 3.0E-06
sp|Q96VT7|DAPB_ASPNG Dipeptidyl-aminopeptidase B OS=Aspergillus niger GN=dapB PE=3 SV=1 489 764 3.0E-06
sp|C1GT79|DAPB_PARBA Probable dipeptidyl-aminopeptidase B OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=DAPB PE=3 SV=1 495 727 3.0E-06
sp|Q0C8V9|DPP5_ASPTN Probable dipeptidyl-peptidase 5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dpp5 PE=3 SV=1 509 771 3.0E-06
sp|A2QEK7|DAPB_ASPNC Probable dipeptidyl-aminopeptidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dapB PE=3 SV=1 489 764 5.0E-06
sp|Q0CXB1|DAPB_ASPTN Probable dipeptidyl-aminopeptidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dapB PE=3 SV=1 467 649 6.0E-06
sp|A7EQZ1|DAPB_SCLS1 Probable dipeptidyl-aminopeptidase B OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dapB PE=3 SV=1 475 626 9.0E-06
sp|Q5BA58|DPP5_EMENI Probable dipeptidyl-peptidase 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dpp5 PE=1 SV=1 502 771 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008236 serine-type peptidase activity Yes
GO:0006508 proteolysis Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0019538 protein metabolic process No
GO:0016787 hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0017171 serine hydrolase activity No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|111530
MGSSNPSINGISTHPGPEQSRVSDYQRLNPGHTPLQISSQPKIRDVRISPDGKLLLYQVTQFYRPTERTFSELWL
AEIDKPRSSIQLTNGEFNDRSGVFHPDGKRILFLSDRQVPGKSTFIYSLSIDRQISPSSSEYPRGVHPDSNLTKN
DDHAKTKSEPSILTSKFSKKPVQGFEISPDGKWIAFASGDETSLEDLQKVQEKNDAKVIGSKDGFSRLRVYNFET
DEIRTLNNVPNDRQLEGFSWSSDSREILYRLRENRGTEWTEFEVLLQSISITEDSQPKSLGSYPRSPSGSTLWLS
SGHIVSLQSYESQNILDARALHVHRYNHDDTPSVSQQLTSERVYGVNEDAVRMLRAGTPHTGVNTKDGQSFLAME
VSQDTDSRIDIIAFTPHAPCHVHKFTLFHTSSDAIWFNSWDAKRIVNTLNPNEITYVFAGVLSSGPRHEPPNVWS
GSFKIHLTDGEEEKLVGSNMVLSRSNGNLTQLSNHLEWLAEAPKLKTEIIRWKTNDGVELSGLVRFPPGYDPSSP
SHRLPTILFIHGGPYRRDIPDYMPYFCNWRELCASAGYLTISPNYRGSQGRGHSFALTANAGIGVYDWPDCESMV
DEVIARGWADSEKLGVAGWSHGGSLTAWGVTQTKTRYKVAVVGAGATHWETMVTESASPELEAAIGGSPPWTYPQ
NPTATSTTSFGSERKTSPIHNITGITTAILILHGERDERVPLGQSYGFYRGLKRYAAPRGREGAQLVVYPREPHG
FVERRHAQDVMERVLVHFNTYI*
Coding >AgabiH97|111530
ATGGGATCCTCAAACCCATCCATCAACGGAATCTCGACTCATCCAGGACCAGAGCAATCCCGGGTTTCCGATTAC
CAACGTCTAAATCCAGGTCATACACCACTCCAAATATCCTCTCAGCCAAAAATCCGCGACGTCAGAATTAGTCCA
GACGGCAAACTCCTCTTATATCAAGTCACTCAATTTTATCGACCTACCGAACGTACTTTTTCAGAACTTTGGCTG
GCAGAGATCGATAAACCTCGTAGTTCGATCCAACTCACCAATGGGGAGTTTAATGATCGATCGGGCGTTTTTCAC
CCTGATGGAAAGCGGATTTTGTTTCTATCGGATAGACAAGTTCCAGGAAAGTCAACTTTCATCTATAGTCTATCA
ATTGATAGACAGATCTCGCCGTCGTCATCTGAATATCCCCGTGGGGTCCACCCTGACAGTAATCTCACCAAAAAC
GATGACCACGCGAAAACGAAATCCGAGCCTAGTATCTTAACGTCCAAGTTCAGCAAAAAGCCCGTTCAGGGTTTC
GAGATTTCTCCTGATGGGAAATGGATTGCTTTTGCGAGTGGAGATGAAACTAGTTTGGAGGATTTGCAAAAGGTG
CAAGAGAAAAATGACGCTAAAGTGATCGGGTCGAAGGATGGATTTTCTAGACTCCGAGTATACAATTTCGAAACC
GACGAAATCCGTACGCTTAATAACGTCCCGAACGATCGACAACTAGAAGGATTCTCTTGGAGTTCGGATAGTCGA
GAGATCCTTTACCGACTGCGAGAGAATAGAGGGACGGAATGGACAGAATTTGAGGTGTTATTGCAATCCATTTCC
ATCACCGAAGATTCACAGCCGAAATCCTTGGGTAGCTATCCACGATCACCTTCTGGGTCCACTCTCTGGTTATCT
TCTGGACATATCGTCAGTCTTCAAAGCTACGAATCCCAGAACATCCTCGATGCACGTGCACTACACGTTCACCGC
TATAACCATGATGACACTCCCTCGGTATCTCAACAACTCACTTCCGAGCGTGTATATGGAGTTAACGAGGACGCC
GTCCGGATGCTTCGTGCAGGTACTCCTCACACCGGGGTTAACACGAAGGATGGTCAATCTTTTCTTGCTATGGAA
GTCAGTCAGGACACAGATTCACGTATTGACATCATCGCATTTACTCCGCATGCCCCATGCCACGTTCACAAATTC
ACTCTCTTCCATACATCTTCCGATGCAATCTGGTTCAATTCTTGGGATGCCAAACGTATCGTCAACACATTAAAT
CCTAATGAAATCACCTACGTCTTCGCCGGAGTCTTAAGTTCTGGACCCAGACACGAGCCACCGAATGTTTGGTCT
GGTAGTTTCAAGATTCATTTAACTGATGGTGAAGAAGAAAAACTTGTTGGCAGTAACATGGTATTGTCGAGATCG
AATGGAAACCTAACACAACTCTCGAATCATTTGGAATGGCTTGCCGAAGCGCCTAAATTGAAGACGGAAATTATC
AGATGGAAAACCAACGACGGTGTTGAATTAAGTGGACTCGTCAGGTTTCCTCCAGGCTACGATCCCTCATCACCT
TCCCATCGCCTACCCACCATCTTATTCATTCACGGAGGTCCCTACCGTCGTGATATTCCAGACTATATGCCATAT
TTCTGCAACTGGCGAGAACTTTGCGCTTCAGCAGGTTACCTCACCATATCACCCAACTATCGAGGCAGTCAAGGT
CGCGGACACTCATTCGCTCTAACCGCCAACGCAGGTATCGGTGTCTACGATTGGCCCGATTGTGAAAGTATGGTC
GATGAAGTTATCGCTCGAGGATGGGCAGATTCTGAAAAATTAGGAGTTGCTGGTTGGAGTCATGGAGGATCGTTG
ACGGCGTGGGGCGTTACTCAAACTAAAACGAGATATAAAGTGGCCGTTGTAGGTGCCGGAGCTACACATTGGGAA
ACTATGGTCACAGAATCGGCTTCTCCAGAACTCGAGGCAGCAATAGGTGGTTCACCTCCTTGGACTTATCCTCAA
AACCCAACCGCAACAAGCACCACCTCATTCGGTTCCGAACGCAAGACAAGTCCGATCCACAATATCACAGGTATT
ACGACTGCTATTCTCATCTTACACGGTGAACGCGATGAACGTGTGCCACTTGGTCAGTCATATGGGTTTTATCGT
GGTTTGAAACGATATGCTGCGCCACGAGGACGAGAAGGTGCACAACTGGTTGTCTACCCGCGAGAACCCCACGGG
TTCGTGGAGAGAAGACACGCACAAGACGTGATGGAGAGAGTTCTAGTGCATTTCAACACGTACATATGA
Transcript >AgabiH97|111530
ATGGGATCCTCAAACCCATCCATCAACGGAATCTCGACTCATCCAGGACCAGAGCAATCCCGGGTTTCCGATTAC
CAACGTCTAAATCCAGGTCATACACCACTCCAAATATCCTCTCAGCCAAAAATCCGCGACGTCAGAATTAGTCCA
GACGGCAAACTCCTCTTATATCAAGTCACTCAATTTTATCGACCTACCGAACGTACTTTTTCAGAACTTTGGCTG
GCAGAGATCGATAAACCTCGTAGTTCGATCCAACTCACCAATGGGGAGTTTAATGATCGATCGGGCGTTTTTCAC
CCTGATGGAAAGCGGATTTTGTTTCTATCGGATAGACAAGTTCCAGGAAAGTCAACTTTCATCTATAGTCTATCA
ATTGATAGACAGATCTCGCCGTCGTCATCTGAATATCCCCGTGGGGTCCACCCTGACAGTAATCTCACCAAAAAC
GATGACCACGCGAAAACGAAATCCGAGCCTAGTATCTTAACGTCCAAGTTCAGCAAAAAGCCCGTTCAGGGTTTC
GAGATTTCTCCTGATGGGAAATGGATTGCTTTTGCGAGTGGAGATGAAACTAGTTTGGAGGATTTGCAAAAGGTG
CAAGAGAAAAATGACGCTAAAGTGATCGGGTCGAAGGATGGATTTTCTAGACTCCGAGTATACAATTTCGAAACC
GACGAAATCCGTACGCTTAATAACGTCCCGAACGATCGACAACTAGAAGGATTCTCTTGGAGTTCGGATAGTCGA
GAGATCCTTTACCGACTGCGAGAGAATAGAGGGACGGAATGGACAGAATTTGAGGTGTTATTGCAATCCATTTCC
ATCACCGAAGATTCACAGCCGAAATCCTTGGGTAGCTATCCACGATCACCTTCTGGGTCCACTCTCTGGTTATCT
TCTGGACATATCGTCAGTCTTCAAAGCTACGAATCCCAGAACATCCTCGATGCACGTGCACTACACGTTCACCGC
TATAACCATGATGACACTCCCTCGGTATCTCAACAACTCACTTCCGAGCGTGTATATGGAGTTAACGAGGACGCC
GTCCGGATGCTTCGTGCAGGTACTCCTCACACCGGGGTTAACACGAAGGATGGTCAATCTTTTCTTGCTATGGAA
GTCAGTCAGGACACAGATTCACGTATTGACATCATCGCATTTACTCCGCATGCCCCATGCCACGTTCACAAATTC
ACTCTCTTCCATACATCTTCCGATGCAATCTGGTTCAATTCTTGGGATGCCAAACGTATCGTCAACACATTAAAT
CCTAATGAAATCACCTACGTCTTCGCCGGAGTCTTAAGTTCTGGACCCAGACACGAGCCACCGAATGTTTGGTCT
GGTAGTTTCAAGATTCATTTAACTGATGGTGAAGAAGAAAAACTTGTTGGCAGTAACATGGTATTGTCGAGATCG
AATGGAAACCTAACACAACTCTCGAATCATTTGGAATGGCTTGCCGAAGCGCCTAAATTGAAGACGGAAATTATC
AGATGGAAAACCAACGACGGTGTTGAATTAAGTGGACTCGTCAGGTTTCCTCCAGGCTACGATCCCTCATCACCT
TCCCATCGCCTACCCACCATCTTATTCATTCACGGAGGTCCCTACCGTCGTGATATTCCAGACTATATGCCATAT
TTCTGCAACTGGCGAGAACTTTGCGCTTCAGCAGGTTACCTCACCATATCACCCAACTATCGAGGCAGTCAAGGT
CGCGGACACTCATTCGCTCTAACCGCCAACGCAGGTATCGGTGTCTACGATTGGCCCGATTGTGAAAGTATGGTC
GATGAAGTTATCGCTCGAGGATGGGCAGATTCTGAAAAATTAGGAGTTGCTGGTTGGAGTCATGGAGGATCGTTG
ACGGCGTGGGGCGTTACTCAAACTAAAACGAGATATAAAGTGGCCGTTGTAGGTGCCGGAGCTACACATTGGGAA
ACTATGGTCACAGAATCGGCTTCTCCAGAACTCGAGGCAGCAATAGGTGGTTCACCTCCTTGGACTTATCCTCAA
AACCCAACCGCAACAAGCACCACCTCATTCGGTTCCGAACGCAAGACAAGTCCGATCCACAATATCACAGGTATT
ACGACTGCTATTCTCATCTTACACGGTGAACGCGATGAACGTGTGCCACTTGGTCAGTCATATGGGTTTTATCGT
GGTTTGAAACGATATGCTGCGCCACGAGGACGAGAAGGTGCACAACTGGTTGTCTACCCGCGAGAACCCCACGGG
TTCGTGGAGAGAAGACACGCACAAGACGTGATGGAGAGAGTTCTAGTGCATTTCAACACGTACATATGA
Gene >AgabiH97|111530
ATGGGATCCTCAAACCCATCCATCAACGGAATCTCGACTCATCCAGGACCAGAGCAATCCCGGGTTTCCGATTAC
CAACGTCTAAATCCAGGTCATACACCACTCCAAATATCCTCTCAGCCAAAAATCCGCGACGTCAGAATTAGTCCA
GACGGCAAACTCCTCTTATATCAAGTCACTCAATTTTATCGACCTACCGAACGTACTTTTTCAGAACTTTGGCTG
GCAGAGATCGATAAACCTCGTAGTTCGATCCAACTCACCAATGGGGAGTTTAATGATCGATCGGGCGTTTTTCAC
CCTGATGGAAAGCGGATTTTGTTTCTATCGGATAGACAAGTTCCAGGAAAGTCAACTTTCATCTATAGTCTATCA
ATTGATAGACAGATCTCGCCGTCGTCATCTGAATATCCCCGTGGGGTCCACCCTGACAGTAATCTCACCAAAAAC
GATGACCACGCGAAAACGAAATCCGAGCCTAGTATCTTAACGTCCAAGTTCAGCAAAAAGCCCGTTCAGGGTTTC
GAGATTTCTCCTGATGGGAAATGGATTGCTTTTGCGAGTGGAGATGAAACTAGTTTGGAGGATTTGCAAAAGGTG
CAAGAGAAAAATGACGCTAAAGTGATCGGGTCGAAGGATGGATTTTCTAGACTCCGAGTATACAATTTCGAAACC
GACGAAATCCGTACGCTTAATAACGTCCCGAACGATCGACAACTAGAAGGATTCTCTTGGAGTTCGGATAGTCGA
GAGATCCTTTACCGACTGCGAGAGAATAGAGGGACGGAATGGACAGAATTTGAGGTGTTATTGCAATCCATTTCC
ATCACCGAAGATTCACAGCCGAAATCCTTGGGTAGCTATCCACGATCACCTTCTGGGTCCACTCTCTGGTTATCT
TCTGGACATATCGTCAGTCTTCAAAGCTACGAATCCCAGAACATCCTCGATGCACGTGCACTACACGTTCACCGC
TATAACCATGATGACACTCCCTCGGTATCTCAACAACTCACTTCCGAGCGTGTATATGGAGTTAACGAGGACGCC
GTCCGGATGCTTCGTGCAGGTACTCCTCACACCGGGGTTAACACGAAGGATGGTCAATCTTTTCTTGCTATGGAA
GTCAGTCAGGACACAGATTCACGTATTGACATCATCGCATTTACTCCGCATGCCCCATGCCACGTTCACAAATTC
ACTCTCTTCCATACATCTTCCGATGCAATCTGGTTCAATTCTTGGGATGCCAAACGTATCGTCAACACATTAAAT
CCTAATGAAATCACCTACGTCTTCGCCGGAGTCTTAAGTTCTGGACCCAGACACGAGCCACCGAATGTTTGGTCT
GGTAGTTTCAAGATTCATTTAACTGATGGTGAAGAAGAAAAACTTGTTGGCAGTAACATGGTATTGTCGAGATCG
AATGGAAACCTAACACAACTCTCGAATCATTTGGAATGGCTTGCCGAAGCGCCTAAATTGAAGACGGAAATTATC
AGATGGAAAACCAACGACGGTGTTGAATTAAGTGGACTCGTCAGGTTTCCTCCAGGCTACGATCCCTCATCACCT
TCCCATCGCCTACCCACCATCTTATTCATTCACGGAGGTCCCTACCGTCGTGATATTCCAGGTAAGAAGAACTCT
AACCCAAACGATTTCATATTTCTAGTACTGAAATTTTCCTACTCTTCTCTTAGACTATATGCCATATTTCTGCAA
CTGGCGAGAACTTTGCGCTTCAGCAGGTTACCTCACCATATCACCCAACTATCGAGGCAGTCAAGGTCGCGGACA
CTCATTCGCTCTAACCGCCAACGCAGGTATCGGTGTCTACGATTGGCCCGATTGTGAAAGTATGGTCGATGAAGT
TATCGCTCGAGGATGGGCAGATTCTGAAAAATTAGGAGTTGCTGGTTGGAGTCATGGTAAACTGACATTGTCGCG
TGTGTTTTTTTGCTCGTTTTATAACTCTATTTGATAGGAGGATCGTTGACGGCGTGGGGCGTTACTCAAACTAAA
ACGAGATATAAAGTGGCCGTTGTAGGTGCCGGAGCTACACATTGGGAAACTATGGTCACAGAATCGGCTTCTCCA
GAACTCGAGGTACGCAAACACCATCCCGTTCCACTAATGCTTCTACAATTCTGAAAACACATCATATCTAGGCAG
CAATAGGTGGTTCACCTCCTTGGACTTATCCTCAAAACCCAACCGCAACAAGCACCACCTCATTCGGTTCCGAAC
GCAAGACAAGTCCGATCCACAATATCACAGGTATTACGACTGCTATTCTCATCTTACACGGTGAACGCGATGAAC
GTGTGCCACTTGGTCAGTCATATGGGTTTTATCGTGGTTTGAAACGATATGCTGCGCCACGAGGACGAGAAGGTG
CACAACTGGTTGTCTACCCGCGAGAACCCCACGGGCAAGTACCTCTTGAGTGTCTCTCAAAAATTCTTTCTAACG
GATAAATTTACAGGTTCGTGGAGAGAAGACACGCACAAGACGTGATGGAGAGAGTTCTAGTGCATTTCAACACGT
ACATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail