Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|111470
Gene name
Locationscaffold_8:1403368..1404143
Strand+
Gene length (bp)775
Transcript length (bp)714
Coding sequence length (bp)714
Protein length (aa) 238

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 3.46 1.09 5.82
Initials Initials knots 5.77 2.13 9.41
Pileal_Stipeal_center Stage I stipe center 3.55 1.12 5.98
Pileal_Stipeal_shell Stage I stipe shell 4.95 1.79 8.11
DIF_stipe_center Stage II stipe center 4.88 1.78 7.98
DIF_stipe_shell Stage II stipe shell 3.63 1.22 6.05
DIF_stipe_skin Stage II stipe skin 4.33 1.54 7.11
DIF_cap_skin Stage II cap skin 2.43 0.64 4.21
DIF_cap_tissue Stage II cap tissue 3.34 1.07 5.61
DIF_gill_tissue Stage II gill tissue 2.93 0.90 4.96
YFB_stipe_center Young fruiting body stipe center 3.34 1.06 5.62
YFB_stipe_shell Young fruiting body stipe shell 3.56 1.13 5.99
YFB_stipe_skin Young fruiting body stipe skin 3.66 1.23 6.09
YFB_cap_skin Young fruiting body cap skin 2.48 0.67 4.28
YFB_cap_tissue Young fruiting body cap tissue 2.43 0.60 4.27
YFB_gill_tissue Young fruiting body gill tissue 3.59 1.16 6.02
YFB_veil Young fruiting body veil 3.28 1.05 5.52

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.841253 no
Casing YFB_stipe_center 0.969909 no
Casing YFB_stipe_shell 0.975429 no
Casing YFB_stipe_skin 0.949175 no
Casing YFB_cap_skin 0.627976 no
Casing YFB_cap_tissue 0.618584 no
Casing YFB_gill_tissue 0.968194 no
Casing YFB_veil 0.956369 no
Casing Initials 0.331262 no
Casing Pileal_Stipeal_center 0.976932 no
Casing Pileal_Stipeal_shell 0.553908 no
Casing DIF_stipe_center 0.575213 no
Casing DIF_stipe_shell 0.956257 no
Casing DIF_stipe_skin 0.754440 no
Casing DIF_cap_skin 0.601269 no
Casing DIF_cap_tissue 0.970108 no
DIF_gill_tissue YFB_stipe_center 0.880929 no
DIF_gill_tissue YFB_stipe_shell 0.806771 no
DIF_gill_tissue YFB_stipe_skin 0.757013 no
DIF_gill_tissue YFB_cap_skin 0.844650 no
DIF_gill_tissue YFB_cap_tissue 0.830856 no
DIF_gill_tissue YFB_gill_tissue 0.796931 no
DIF_gill_tissue YFB_veil 0.900765 no
YFB_stipe_center YFB_stipe_shell 0.945624 no
YFB_stipe_center YFB_stipe_skin 0.915400 no
YFB_stipe_center YFB_cap_skin 0.672696 no
YFB_stipe_center YFB_cap_tissue 0.660228 no
YFB_stipe_center YFB_gill_tissue 0.939601 no
YFB_stipe_center YFB_veil 0.985097 no
YFB_stipe_shell YFB_stipe_skin 0.974850 no
YFB_stipe_shell YFB_cap_skin 0.584223 no
YFB_stipe_shell YFB_cap_tissue 0.578032 no
YFB_stipe_shell YFB_gill_tissue 0.994521 no
YFB_stipe_shell YFB_veil 0.929701 no
YFB_stipe_skin YFB_cap_skin 0.531015 no
YFB_stipe_skin YFB_cap_tissue 0.521395 no
YFB_stipe_skin YFB_gill_tissue 0.983168 no
YFB_stipe_skin YFB_veil 0.899030 no
YFB_cap_skin YFB_cap_tissue 0.984458 no
YFB_cap_skin YFB_gill_tissue 0.572164 no
YFB_cap_skin YFB_veil 0.698274 no
YFB_cap_tissue YFB_gill_tissue 0.563134 no
YFB_cap_tissue YFB_veil 0.682606 no
YFB_gill_tissue YFB_veil 0.920469 no
Initials DIF_gill_tissue 0.162096 no
Initials YFB_stipe_center 0.288884 no
Initials YFB_stipe_shell 0.376239 no
Initials YFB_stipe_skin 0.386027 no
Initials YFB_cap_skin 0.084017 no
Initials YFB_cap_tissue 0.090829 no
Initials YFB_gill_tissue 0.384974 no
Initials YFB_veil 0.272348 no
Initials Pileal_Stipeal_center 0.370347 no
Initials Pileal_Stipeal_shell 0.841593 no
Initials DIF_stipe_center 0.821237 no
Initials DIF_stipe_shell 0.377028 no
Initials DIF_stipe_skin 0.645992 no
Initials DIF_cap_skin 0.068640 no
Initials DIF_cap_tissue 0.291749 no
Pileal_Stipeal_center DIF_gill_tissue 0.809347 no
Pileal_Stipeal_center YFB_stipe_center 0.947818 no
Pileal_Stipeal_center YFB_stipe_shell 0.995138 no
Pileal_Stipeal_center YFB_stipe_skin 0.973583 no
Pileal_Stipeal_center YFB_cap_skin 0.589465 no
Pileal_Stipeal_center YFB_cap_tissue 0.582808 no
Pileal_Stipeal_center YFB_gill_tissue 0.990850 no
Pileal_Stipeal_center YFB_veil 0.932566 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.594232 no
Pileal_Stipeal_center DIF_stipe_center 0.613438 no
Pileal_Stipeal_center DIF_stipe_shell 0.979951 no
Pileal_Stipeal_center DIF_stipe_skin 0.789105 no
Pileal_Stipeal_center DIF_cap_skin 0.562908 no
Pileal_Stipeal_center DIF_cap_tissue 0.947574 no
Pileal_Stipeal_shell DIF_gill_tissue 0.322249 no
Pileal_Stipeal_shell YFB_stipe_center 0.500103 no
Pileal_Stipeal_shell YFB_stipe_shell 0.594542 no
Pileal_Stipeal_shell YFB_stipe_skin 0.620140 no
Pileal_Stipeal_shell YFB_cap_skin 0.175675 no
Pileal_Stipeal_shell YFB_cap_tissue 0.180324 no
Pileal_Stipeal_shell YFB_gill_tissue 0.607845 no
Pileal_Stipeal_shell YFB_veil 0.475568 no
Pileal_Stipeal_shell DIF_stipe_center 0.987316 no
Pileal_Stipeal_shell DIF_stipe_shell 0.606480 no
Pileal_Stipeal_shell DIF_stipe_skin 0.861792 no
Pileal_Stipeal_shell DIF_cap_skin 0.151108 no
Pileal_Stipeal_shell DIF_cap_tissue 0.500971 no
DIF_stipe_center DIF_gill_tissue 0.344404 no
DIF_stipe_center YFB_stipe_center 0.526593 no
DIF_stipe_center YFB_stipe_shell 0.622967 no
DIF_stipe_center YFB_stipe_skin 0.649350 no
DIF_stipe_center YFB_cap_skin 0.189035 no
DIF_stipe_center YFB_cap_tissue 0.194610 no
DIF_stipe_center YFB_gill_tissue 0.636278 no
DIF_stipe_center YFB_veil 0.498900 no
DIF_stipe_center DIF_stipe_shell 0.637596 no
DIF_stipe_center DIF_stipe_skin 0.883204 no
DIF_stipe_center DIF_cap_skin 0.166446 no
DIF_stipe_center DIF_cap_tissue 0.527470 no
DIF_stipe_shell DIF_gill_tissue 0.768859 no
DIF_stipe_shell YFB_stipe_center 0.922233 no
DIF_stipe_shell YFB_stipe_shell 0.981653 no
DIF_stipe_shell YFB_stipe_skin 0.994271 no
DIF_stipe_shell YFB_cap_skin 0.537876 no
DIF_stipe_shell YFB_cap_tissue 0.527537 no
DIF_stipe_shell YFB_gill_tissue 0.988269 no
DIF_stipe_shell YFB_veil 0.906251 no
DIF_stipe_shell DIF_stipe_skin 0.812559 no
DIF_stipe_shell DIF_cap_skin 0.506011 no
DIF_stipe_shell DIF_cap_tissue 0.921998 no
DIF_stipe_skin DIF_gill_tissue 0.505238 no
DIF_stipe_skin YFB_stipe_center 0.700504 no
DIF_stipe_skin YFB_stipe_shell 0.791328 no
DIF_stipe_skin YFB_stipe_skin 0.819112 no
DIF_stipe_skin YFB_cap_skin 0.302508 no
DIF_stipe_skin YFB_cap_tissue 0.306617 no
DIF_stipe_skin YFB_gill_tissue 0.803002 no
DIF_stipe_skin YFB_veil 0.678685 no
DIF_stipe_skin DIF_cap_skin 0.276147 no
DIF_stipe_skin DIF_cap_tissue 0.700639 no
DIF_cap_skin DIF_gill_tissue 0.825244 no
DIF_cap_skin YFB_stipe_center 0.647578 no
DIF_cap_skin YFB_stipe_shell 0.564102 no
DIF_cap_skin YFB_stipe_skin 0.500971 no
DIF_cap_skin YFB_cap_skin 0.983795 no
DIF_cap_skin YFB_cap_tissue 0.994125 no
DIF_cap_skin YFB_gill_tissue 0.550251 no
DIF_cap_skin YFB_veil 0.674590 no
DIF_cap_skin DIF_cap_tissue 0.647862 no
DIF_cap_tissue DIF_gill_tissue 0.879805 no
DIF_cap_tissue YFB_stipe_center 0.994551 no
DIF_cap_tissue YFB_stipe_shell 0.946100 no
DIF_cap_tissue YFB_stipe_skin 0.916413 no
DIF_cap_tissue YFB_cap_skin 0.676927 no
DIF_cap_tissue YFB_cap_tissue 0.665242 no
DIF_cap_tissue YFB_gill_tissue 0.939991 no
DIF_cap_tissue YFB_veil 0.985076 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|111470
MVYPGILIFLTLAIFQWALACETECKDGVTNVFVGNYSSPVHQVFRKLGERLSDRLSLNEDPQYYLQPINDTFHK
EAYDFIQNAIFSRFHGKCQDVTTGINPIGCPNPSCPVICGTPGSLVYHYPELEAIVHTAVKALLVQIVKPSSPAY
SNSSSRIYQAYHSNNMVRSWLRFSPAHVPGTYGVSDRHTLNQSLSGVFRDIPSLLDNECGGPRKDAPHTFPRCSW
KKTMTKYILRFP*
Coding >AgabiH97|111470
ATGGTTTATCCCGGGATTCTTATCTTTCTGACTCTGGCCATTTTCCAGTGGGCTCTGGCGTGTGAAACAGAGTGC
AAGGATGGCGTCACCAATGTTTTCGTCGGTAACTACTCGAGCCCCGTTCACCAAGTCTTCCGCAAGCTCGGCGAA
CGGCTATCTGACCGGCTTTCCCTCAACGAGGATCCTCAATATTACCTCCAACCGATCAATGATACCTTTCACAAG
GAAGCATATGACTTCATACAGAATGCAATATTTTCCCGCTTTCACGGAAAATGCCAAGACGTGACTACTGGAATC
AATCCCATTGGATGTCCTAATCCCAGTTGCCCTGTCATCTGCGGCACACCTGGCTCTCTGGTTTATCATTATCCG
GAACTCGAGGCGATCGTACACACGGCTGTCAAGGCTCTCTTGGTTCAAATCGTGAAACCCTCTTCTCCGGCATAT
TCCAATTCTTCGTCCCGCATATATCAAGCTTATCACTCCAATAACATGGTTAGATCGTGGCTTCGATTTTCTCCT
GCCCACGTTCCTGGAACATACGGGGTCTCGGATAGGCACACCCTAAACCAAAGTCTTTCGGGTGTCTTTCGTGAT
ATTCCTTCTCTCCTTGACAATGAATGTGGTGGGCCACGGAAGGATGCACCTCATACTTTCCCCCGTTGCAGCTGG
AAGAAAACTATGACCAAGTACATTCTCAGATTCCCATGA
Transcript >AgabiH97|111470
ATGGTTTATCCCGGGATTCTTATCTTTCTGACTCTGGCCATTTTCCAGTGGGCTCTGGCGTGTGAAACAGAGTGC
AAGGATGGCGTCACCAATGTTTTCGTCGGTAACTACTCGAGCCCCGTTCACCAAGTCTTCCGCAAGCTCGGCGAA
CGGCTATCTGACCGGCTTTCCCTCAACGAGGATCCTCAATATTACCTCCAACCGATCAATGATACCTTTCACAAG
GAAGCATATGACTTCATACAGAATGCAATATTTTCCCGCTTTCACGGAAAATGCCAAGACGTGACTACTGGAATC
AATCCCATTGGATGTCCTAATCCCAGTTGCCCTGTCATCTGCGGCACACCTGGCTCTCTGGTTTATCATTATCCG
GAACTCGAGGCGATCGTACACACGGCTGTCAAGGCTCTCTTGGTTCAAATCGTGAAACCCTCTTCTCCGGCATAT
TCCAATTCTTCGTCCCGCATATATCAAGCTTATCACTCCAATAACATGGTTAGATCGTGGCTTCGATTTTCTCCT
GCCCACGTTCCTGGAACATACGGGGTCTCGGATAGGCACACCCTAAACCAAAGTCTTTCGGGTGTCTTTCGTGAT
ATTCCTTCTCTCCTTGACAATGAATGTGGTGGGCCACGGAAGGATGCACCTCATACTTTCCCCCGTTGCAGCTGG
AAGAAAACTATGACCAAGTACATTCTCAGATTCCCATGA
Gene >AgabiH97|111470
ATGGTTTATCCCGGGATTCTTATCTTTCTGACTCTGGCCATTTTCCAGTGGGCTCTGGCGTGTGAAACAGAGTGC
AAGGATGGCGTCACCAATGTTTTCGTCGGTAACTACTCGAGCCCCGTTCACCAAGTCTTCCGCAAGCTCGTATGC
CGCCTCTTTGGACTCTCGCTGGATTGACTTTGCTCAGAATGAATTTCATTATCAGGGCGAACGGCTATCTGACCG
GCTTTCCCTCAACGAGGATCCTCAATATTACCTCCAACCGATCAATGATACCTTTCACAAGGAAGCATATGACTT
CATACAGAATGCAATATTTTCCCGCTTTCACGGAAAATGCCAAGACGTGACTACTGGAATCAATCCCATTGGATG
TCCTAATCCCAGTTGCCCTGTCATCTGCGGCACACCTGGCTCTCTGGTTTATCATTATCCGGAACTCGAGGCGAT
CGTACACACGGCTGTCAAGGCTCTCTTGGTTCAAATCGTGAAACCCTCTTCTCCGGCATATTCCAATTCTTCGTC
CCGCATATATCAAGCTTATCACTCCAATAACATGGTTAGATCGTGGCTTCGATTTTCTCCTGCCCACGTTCCTGG
AACATACGGGGTCTCGGATAGGCACACCCTAAACCAAAGTCTTTCGGGTGTCTTTCGTGATATTCCTTCTCTCCT
TGACAATGAATGTGGTGGGCCACGGAAGGATGCACCTCATACTTTCCCCCGTTGCAGCTGGAAGAAAACTATGAC
CAAGTACATTCTCAGATTCCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail