Protein ID | AgabiH97|111250 |
Gene name | |
Location | scaffold_8:1332297..1333561 |
Strand | - |
Gene length (bp) | 1264 |
Transcript length (bp) | 1059 |
Coding sequence length (bp) | 1059 |
Protein length (aa) | 353 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF01207 | Dus | Dihydrouridine synthase (Dus) | 1.5E-59 | 10 | 239 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q6P1R4|DUS1L_HUMAN | tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Homo sapiens GN=DUS1L PE=1 SV=1 | 7 | 270 | 5.0E-49 |
sp|Q8C2P3|DUS1L_MOUSE | tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Mus musculus GN=Dus1l PE=2 SV=1 | 7 | 270 | 7.0E-49 |
sp|Q8K582|DUS1L_RAT | tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Rattus norvegicus GN=Dus1l PE=2 SV=1 | 7 | 270 | 1.0E-48 |
sp|Q9HGN6|DUS1_SCHPO | tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus1 PE=3 SV=1 | 5 | 270 | 4.0E-48 |
sp|P53759|DUS1_YEAST | tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS1 PE=1 SV=1 | 9 | 269 | 4.0E-45 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q6P1R4|DUS1L_HUMAN | tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Homo sapiens GN=DUS1L PE=1 SV=1 | 7 | 270 | 5.0E-49 |
sp|Q8C2P3|DUS1L_MOUSE | tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Mus musculus GN=Dus1l PE=2 SV=1 | 7 | 270 | 7.0E-49 |
sp|Q8K582|DUS1L_RAT | tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Rattus norvegicus GN=Dus1l PE=2 SV=1 | 7 | 270 | 1.0E-48 |
sp|Q9HGN6|DUS1_SCHPO | tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus1 PE=3 SV=1 | 5 | 270 | 4.0E-48 |
sp|P53759|DUS1_YEAST | tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS1 PE=1 SV=1 | 9 | 269 | 4.0E-45 |
sp|O95620|DUS4L_HUMAN | tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Homo sapiens GN=DUS4L PE=2 SV=2 | 9 | 299 | 1.0E-35 |
sp|Q32M08|DUS4L_MOUSE | tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Mus musculus GN=Dus4l PE=2 SV=1 | 9 | 249 | 2.0E-34 |
sp|Q8ZAX7|DUSB_YERPE | tRNA-dihydrouridine synthase B OS=Yersinia pestis GN=dusB PE=3 SV=1 | 8 | 238 | 3.0E-31 |
sp|P45672|DUS_AZOBR | Probable tRNA-dihydrouridine synthase OS=Azospirillum brasilense GN=dus PE=3 SV=1 | 9 | 243 | 2.0E-29 |
sp|P0A2R6|DUSB_SALTY | tRNA-dihydrouridine synthase B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dusB PE=3 SV=1 | 3 | 238 | 6.0E-29 |
sp|P0A2R7|DUSB_SALTI | tRNA-dihydrouridine synthase B OS=Salmonella typhi GN=dusB PE=3 SV=1 | 3 | 238 | 6.0E-29 |
sp|O52539|DUSB_PECCA | tRNA-dihydrouridine synthase B OS=Pectobacterium carotovorum GN=dusB PE=3 SV=2 | 7 | 238 | 3.0E-28 |
sp|Q9CLW3|DUSB_PASMU | tRNA-dihydrouridine synthase B OS=Pasteurella multocida (strain Pm70) GN=dusB PE=3 SV=2 | 3 | 260 | 3.0E-28 |
sp|P0ABT5|DUSB_ECOLI | tRNA-dihydrouridine synthase B OS=Escherichia coli (strain K12) GN=dusB PE=3 SV=1 | 3 | 301 | 4.0E-28 |
sp|P0ABT6|DUSB_ECOL6 | tRNA-dihydrouridine synthase B OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dusB PE=3 SV=1 | 3 | 301 | 4.0E-28 |
sp|P0ABT7|DUSB_ECO57 | tRNA-dihydrouridine synthase B OS=Escherichia coli O157:H7 GN=dusB PE=3 SV=1 | 3 | 301 | 4.0E-28 |
sp|O52533|DUSB_PROVU | tRNA-dihydrouridine synthase B OS=Proteus vulgaris GN=dusB PE=3 SV=2 | 8 | 276 | 6.0E-28 |
sp|O52536|DUSB_KLEPN | tRNA-dihydrouridine synthase B OS=Klebsiella pneumoniae GN=dusB PE=3 SV=1 | 3 | 238 | 8.0E-28 |
sp|Q55724|DUS1_SYNY3 | Probable tRNA-dihydrouridine synthase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dus1 PE=3 SV=1 | 7 | 270 | 2.0E-27 |
sp|Q87KU1|DUSB_VIBPA | tRNA-dihydrouridine synthase B OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dusB PE=3 SV=2 | 8 | 238 | 3.0E-27 |
sp|Q83PZ5|DUSB_SHIFL | tRNA-dihydrouridine synthase B OS=Shigella flexneri GN=dusB PE=3 SV=1 | 3 | 238 | 4.0E-27 |
sp|Q8PP72|DUSB_XANAC | tRNA-dihydrouridine synthase B OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dusB PE=3 SV=1 | 7 | 239 | 4.0E-27 |
sp|Q06063|DUS4_YEAST | tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS4 PE=1 SV=1 | 9 | 275 | 4.0E-26 |
sp|P41504|DUS_RHILP | Probable tRNA-dihydrouridine synthase OS=Rhizobium leguminosarum bv. phaseoli GN=dus PE=3 SV=1 | 3 | 294 | 4.0E-26 |
sp|Q8PCH1|DUSB_XANCP | tRNA-dihydrouridine synthase B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dusB PE=3 SV=1 | 7 | 239 | 5.0E-26 |
sp|O74553|DUS4_SCHPO | tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus4 PE=3 SV=1 | 9 | 237 | 1.0E-25 |
sp|Q9D7B1|DUS2L_MOUSE | tRNA-dihydrouridine(20) synthase [NAD(P)+]-like OS=Mus musculus GN=Dus2 PE=1 SV=1 | 7 | 257 | 1.0E-25 |
sp|Q9NX74|DUS2L_HUMAN | tRNA-dihydrouridine(20) synthase [NAD(P)+]-like OS=Homo sapiens GN=DUS2 PE=1 SV=1 | 7 | 257 | 2.0E-25 |
sp|P44965|DUSB_HAEIN | tRNA-dihydrouridine synthase B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dusB PE=3 SV=1 | 3 | 236 | 2.0E-25 |
sp|Q9KV66|DUSB_VIBCH | tRNA-dihydrouridine synthase B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dusB PE=3 SV=2 | 8 | 259 | 2.0E-25 |
sp|O52532|DUSB_SERMA | tRNA-dihydrouridine synthase B OS=Serratia marcescens GN=dusB PE=3 SV=2 | 8 | 238 | 4.0E-25 |
sp|Q8CWL2|DUSB_VIBVU | tRNA-dihydrouridine synthase B OS=Vibrio vulnificus (strain CMCP6) GN=dusB PE=3 SV=2 | 7 | 259 | 6.0E-25 |
sp|Q09504|YQI2_CAEEL | Uncharacterized tRNA-dihydrouridine synthase-like protein C45G9.2 OS=Caenorhabditis elegans GN=C45G9.2 PE=3 SV=2 | 13 | 257 | 9.0E-25 |
sp|Q1RH84|DUS_RICBR | Probable tRNA-dihydrouridine synthase OS=Rickettsia bellii (strain RML369-C) GN=dus PE=3 SV=1 | 8 | 238 | 1.0E-23 |
sp|Q92JQ6|DUS_RICCN | Probable tRNA-dihydrouridine synthase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=dus PE=3 SV=2 | 8 | 238 | 2.0E-23 |
sp|Q9HUW1|DUSB_PSEAE | tRNA-dihydrouridine synthase B OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dusB PE=3 SV=1 | 7 | 238 | 2.0E-23 |
sp|Q8EJR8|DUSB_SHEON | tRNA-dihydrouridine synthase B OS=Shewanella oneidensis (strain MR-1) GN=dusB PE=3 SV=1 | 7 | 238 | 4.0E-23 |
sp|Q88DK5|DUSB_PSEPK | tRNA-dihydrouridine synthase B OS=Pseudomonas putida (strain KT2440) GN=dusB PE=3 SV=1 | 5 | 287 | 8.0E-23 |
sp|P37567|DUS1_BACSU | Probable tRNA-dihydrouridine synthase 1 OS=Bacillus subtilis (strain 168) GN=dus1 PE=3 SV=1 | 3 | 240 | 3.0E-22 |
sp|Q7VNP2|DUSB_HAEDU | tRNA-dihydrouridine synthase B OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dusB PE=3 SV=1 | 7 | 238 | 3.0E-22 |
sp|Q4UNJ4|DUS_RICFE | Probable tRNA-dihydrouridine synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=dus PE=3 SV=1 | 9 | 238 | 7.0E-22 |
sp|Q9ZED2|DUS_RICPR | Probable tRNA-dihydrouridine synthase OS=Rickettsia prowazekii (strain Madrid E) GN=dus PE=3 SV=2 | 9 | 273 | 1.0E-21 |
sp|Q68XZ3|DUS_RICTY | Probable tRNA-dihydrouridine synthase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dus PE=3 SV=1 | 9 | 273 | 2.0E-21 |
sp|Q9ZLB6|DUS_HELPJ | Probable tRNA-dihydrouridine synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=dus PE=3 SV=1 | 3 | 293 | 2.0E-21 |
sp|O25427|DUS_HELPY | Probable tRNA-dihydrouridine synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dus PE=3 SV=1 | 3 | 259 | 4.0E-21 |
sp|O67533|DUS_AQUAE | Probable tRNA-dihydrouridine synthase OS=Aquifex aeolicus (strain VF5) GN=dus PE=3 SV=1 | 1 | 257 | 8.0E-21 |
sp|Q87VS1|DUSB_PSESM | tRNA-dihydrouridine synthase B OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dusB PE=3 SV=1 | 8 | 287 | 1.0E-20 |
sp|P44606|DUSC_HAEIN | tRNA-dihydrouridine(16) synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dusC PE=3 SV=1 | 6 | 233 | 4.0E-19 |
sp|Q9CL29|DUSA_PASMU | tRNA-dihydrouridine(20/20a) synthase OS=Pasteurella multocida (strain Pm70) GN=dusA PE=3 SV=1 | 5 | 233 | 7.0E-19 |
sp|O74731|DUS2_SCHPO | tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus2 PE=3 SV=1 | 7 | 236 | 1.0E-18 |
sp|Q54CU9|DUS3L_DICDI | tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Dictyostelium discoideum GN=dus3l PE=3 SV=1 | 2 | 238 | 2.0E-18 |
sp|Q5SMC7|DUSAL_THET8 | tRNA-dihydrouridine(20/20a) synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dus PE=1 SV=1 | 7 | 239 | 7.0E-18 |
sp|P9WNS7|DUS_MYCTU | Probable tRNA-dihydrouridine synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dus PE=1 SV=1 | 9 | 304 | 2.0E-17 |
sp|P9WNS6|DUS_MYCTO | Probable tRNA-dihydrouridine synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dus PE=3 SV=1 | 9 | 304 | 2.0E-17 |
sp|P53720|DUS2_YEAST | tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMM1 PE=1 SV=1 | 7 | 257 | 3.0E-17 |
sp|P72872|DUSAL_SYNY3 | tRNA-dihydrouridine(20/20a) synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dus2 PE=3 SV=1 | 10 | 237 | 5.0E-17 |
sp|Q87N01|DUSC_VIBPA | tRNA-dihydrouridine(16) synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dusC PE=3 SV=1 | 6 | 225 | 8.0E-17 |
sp|P44794|DUSA_HAEIN | tRNA-dihydrouridine(20/20a) synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dusA PE=3 SV=1 | 5 | 233 | 7.0E-16 |
sp|Q9CJW1|DUSC_PASMU | tRNA-dihydrouridine(16) synthase OS=Pasteurella multocida (strain Pm70) GN=dusC PE=3 SV=1 | 6 | 257 | 2.0E-15 |
sp|Q8ZJ14|DUSA_YERPE | tRNA-dihydrouridine(20/20a) synthase OS=Yersinia pestis GN=dusA PE=3 SV=1 | 7 | 239 | 2.0E-15 |
sp|Q08111|DUS_RHOCB | Probable tRNA-dihydrouridine synthase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=dus PE=3 SV=1 | 11 | 234 | 3.0E-15 |
sp|Q8XEC6|DUSC_ECO57 | tRNA-dihydrouridine(16) synthase OS=Escherichia coli O157:H7 GN=dusC PE=3 SV=1 | 6 | 233 | 4.0E-15 |
sp|Q8ZNM4|DUSC_SALTY | tRNA-dihydrouridine(16) synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dusC PE=3 SV=1 | 6 | 233 | 6.0E-15 |
sp|Q8Z5B2|DUSC_SALTI | tRNA-dihydrouridine(16) synthase OS=Salmonella typhi GN=dusC PE=3 SV=1 | 6 | 233 | 7.0E-15 |
sp|Q8FFV5|DUSC_ECOL6 | tRNA-dihydrouridine(16) synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dusC PE=3 SV=2 | 6 | 233 | 9.0E-15 |
sp|Q7UC91|DUSC_SHIFL | tRNA-dihydrouridine(16) synthase OS=Shigella flexneri GN=dusC PE=3 SV=1 | 6 | 233 | 1.0E-14 |
sp|P33371|DUSC_ECOLI | tRNA-dihydrouridine(16) synthase OS=Escherichia coli (strain K12) GN=dusC PE=1 SV=1 | 6 | 233 | 1.0E-14 |
sp|Q8EFG7|DUSC_SHEON | tRNA-dihydrouridine(16) synthase OS=Shewanella oneidensis (strain MR-1) GN=dusC PE=3 SV=1 | 6 | 233 | 2.0E-14 |
sp|Q0CZL3|DUS3_ASPTN | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dus3 PE=3 SV=1 | 11 | 238 | 8.0E-14 |
sp|Q28BT8|DUS3L_XENTR | tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Xenopus tropicalis GN=dus3l PE=2 SV=2 | 5 | 238 | 1.0E-13 |
sp|A1CNY3|DUS3_ASPCL | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dus3 PE=3 SV=1 | 11 | 238 | 1.0E-13 |
sp|Q8DAH1|DUSC_VIBVU | tRNA-dihydrouridine(16) synthase OS=Vibrio vulnificus (strain CMCP6) GN=dusC PE=3 SV=2 | 6 | 233 | 1.0E-13 |
sp|Q9KT00|DUSC_VIBCH | tRNA-dihydrouridine(16) synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dusC PE=3 SV=1 | 6 | 233 | 2.0E-13 |
sp|Q7UBC5|DUSA_SHIFL | tRNA-dihydrouridine(20/20a) synthase OS=Shigella flexneri GN=dusA PE=3 SV=3 | 7 | 279 | 3.0E-13 |
sp|Q7VKU5|DUSC_HAEDU | tRNA-dihydrouridine(16) synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dusC PE=3 SV=1 | 1 | 233 | 3.0E-13 |
sp|Q8ZGV2|DUSC_YERPE | tRNA-dihydrouridine(16) synthase OS=Yersinia pestis GN=dusC PE=3 SV=2 | 6 | 233 | 4.0E-13 |
sp|Q7VNV2|DUSA_HAEDU | tRNA-dihydrouridine(20/20a) synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dusA PE=3 SV=1 | 5 | 238 | 4.0E-13 |
sp|Q7ZWS1|DUS3L_XENLA | tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Xenopus laevis GN=dus3l PE=2 SV=1 | 5 | 238 | 5.0E-13 |
sp|Q3KRC5|DUS3L_RAT | tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Rattus norvegicus GN=Dus3l PE=2 SV=1 | 7 | 238 | 6.0E-13 |
sp|Q50049|DUS_MYCLE | Probable tRNA-dihydrouridine synthase OS=Mycobacterium leprae (strain TN) GN=dus PE=3 SV=1 | 11 | 238 | 6.0E-13 |
sp|Q9KUX9|DUSA_VIBCH | tRNA-dihydrouridine(20/20a) synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dusA PE=3 SV=1 | 7 | 239 | 6.0E-13 |
sp|P32695|DUSA_ECOLI | tRNA-dihydrouridine(20/20a) synthase OS=Escherichia coli (strain K12) GN=dusA PE=1 SV=4 | 7 | 246 | 8.0E-13 |
sp|Q8X5V6|DUSA_ECO57 | tRNA-dihydrouridine(20/20a) synthase OS=Escherichia coli O157:H7 GN=dusA PE=3 SV=3 | 7 | 246 | 8.0E-13 |
sp|A6QYC6|DUS3_AJECN | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DUS3 PE=3 SV=1 | 2 | 238 | 1.0E-12 |
sp|A8NZY7|DUS3_COPC7 | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=DUS3 PE=3 SV=1 | 11 | 238 | 1.0E-12 |
sp|Q8FB30|DUSA_ECOL6 | tRNA-dihydrouridine(20/20a) synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dusA PE=3 SV=1 | 7 | 246 | 1.0E-12 |
sp|Q7XT07|DUS3L_ORYSJ | tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Oryza sativa subsp. japonica GN=Os04g0117600 PE=2 SV=2 | 5 | 238 | 1.0E-12 |
sp|Q8EAJ0|DUSA_SHEON | tRNA-dihydrouridine(20/20a) synthase OS=Shewanella oneidensis (strain MR-1) GN=dusA PE=3 SV=1 | 8 | 275 | 2.0E-12 |
sp|Q8XYX1|DUSC_RALSO | tRNA-dihydrouridine(16) synthase OS=Ralstonia solanacearum (strain GMI1000) GN=dusC PE=3 SV=1 | 7 | 235 | 2.0E-12 |
sp|Q96G46|DUS3L_HUMAN | tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens GN=DUS3L PE=1 SV=2 | 5 | 238 | 4.0E-12 |
sp|Q9AMN9|DUSC_PSEAC | tRNA-dihydrouridine(16) synthase OS=Pseudomonas alcaligenes GN=dusC PE=3 SV=1 | 6 | 233 | 5.0E-12 |
sp|Q8CWK7|DUSA_VIBVU | tRNA-dihydrouridine(20/20a) synthase OS=Vibrio vulnificus (strain CMCP6) GN=dusA PE=3 SV=2 | 7 | 237 | 6.0E-12 |
sp|A8PTG4|DUS3_MALGO | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=DUS3 PE=3 SV=1 | 11 | 238 | 8.0E-12 |
sp|Q87L85|DUSA_VIBPA | tRNA-dihydrouridine(20/20a) synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dusA PE=3 SV=1 | 7 | 237 | 9.0E-12 |
sp|Q9T0J6|DUS3L_ARATH | tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Arabidopsis thaliana GN=At4g38890 PE=1 SV=2 | 5 | 274 | 1.0E-11 |
sp|Q8Z1T1|DUSA_SALTI | tRNA-dihydrouridine(20/20a) synthase OS=Salmonella typhi GN=dusA PE=3 SV=1 | 7 | 237 | 1.0E-11 |
sp|Q1E2F4|DUS3_COCIM | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Coccidioides immitis (strain RS) GN=DUS3 PE=3 SV=1 | 2 | 238 | 2.0E-11 |
sp|A6RMI1|DUS3_BOTFB | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Botryotinia fuckeliana (strain B05.10) GN=dus3 PE=3 SV=1 | 9 | 238 | 3.0E-11 |
sp|O83945|DUS_TREPA | Probable tRNA-dihydrouridine synthase OS=Treponema pallidum (strain Nichols) GN=dus PE=3 SV=1 | 11 | 239 | 3.0E-11 |
sp|A1D1U0|DUS3_NEOFI | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dus3 PE=3 SV=1 | 11 | 238 | 5.0E-11 |
sp|Q91XI1|DUS3L_MOUSE | tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Mus musculus GN=Dus3l PE=1 SV=1 | 7 | 238 | 5.0E-11 |
sp|O68273|DUSC_CUPNH | tRNA-dihydrouridine(16) synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dusC PE=3 SV=2 | 7 | 235 | 6.0E-11 |
sp|A7EKL8|DUS3_SCLS1 | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dus3 PE=3 SV=1 | 9 | 238 | 6.0E-11 |
sp|Q8ZKH4|DUSA_SALTY | tRNA-dihydrouridine(20/20a) synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dusA PE=3 SV=1 | 7 | 237 | 1.0E-10 |
sp|Q88LF2|DUSC_PSEPK | tRNA-dihydrouridine(16) synthase OS=Pseudomonas putida (strain KT2440) GN=dusC PE=3 SV=1 | 6 | 233 | 2.0E-10 |
sp|P67717|DUS_STAAN | Probable tRNA-dihydrouridine synthase OS=Staphylococcus aureus (strain N315) GN=dus PE=1 SV=1 | 8 | 236 | 2.0E-10 |
sp|P67716|DUS_STAAM | Probable tRNA-dihydrouridine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dus PE=3 SV=1 | 8 | 236 | 2.0E-10 |
sp|P0CN29|DUS3_CRYNB | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DUS3 PE=3 SV=1 | 11 | 238 | 3.0E-10 |
sp|P0CN28|DUS3_CRYNJ | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DUS3 PE=3 SV=1 | 11 | 238 | 3.0E-10 |
sp|Q6GKK9|DUS_STAAR | Probable tRNA-dihydrouridine synthase OS=Staphylococcus aureus (strain MRSA252) GN=dus PE=3 SV=1 | 8 | 236 | 3.0E-10 |
sp|Q4WRX4|DUS3_ASPFU | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dus3 PE=3 SV=1 | 11 | 238 | 3.0E-10 |
sp|Q8NYV4|DUS_STAAW | Probable tRNA-dihydrouridine synthase OS=Staphylococcus aureus (strain MW2) GN=dus PE=3 SV=1 | 8 | 236 | 3.0E-10 |
sp|Q6GD38|DUS_STAAS | Probable tRNA-dihydrouridine synthase OS=Staphylococcus aureus (strain MSSA476) GN=dus PE=3 SV=1 | 8 | 236 | 3.0E-10 |
sp|Q5HJT5|DUS_STAAC | Probable tRNA-dihydrouridine synthase OS=Staphylococcus aureus (strain COL) GN=dus PE=3 SV=2 | 8 | 236 | 3.0E-10 |
sp|Q9HZ95|DUSC_PSEAE | tRNA-dihydrouridine(16) synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dusC PE=3 SV=1 | 6 | 233 | 3.0E-10 |
sp|Q0U9D6|DUS3_PHANO | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DUS3 PE=3 SV=2 | 9 | 238 | 4.0E-10 |
sp|Q884C6|DUSC_PSESM | tRNA-dihydrouridine(16) synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dusC PE=3 SV=1 | 6 | 233 | 7.0E-10 |
sp|Q8P3X4|DUSA_XANCP | tRNA-dihydrouridine(20/20a) synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dusA PE=3 SV=1 | 4 | 238 | 9.0E-10 |
sp|A2QAU6|DUS3_ASPNC | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dus3 PE=3 SV=1 | 11 | 238 | 1.0E-09 |
sp|Q2HDP2|DUS3_CHAGB | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DUS3 PE=3 SV=2 | 2 | 238 | 1.0E-09 |
sp|Q5HKD5|DUS_STAEQ | Probable tRNA-dihydrouridine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dus PE=3 SV=1 | 8 | 236 | 3.0E-09 |
sp|Q5ALL3|DUS3_CANAL | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DUS3 PE=3 SV=1 | 9 | 239 | 4.0E-09 |
sp|Q5BF62|DUS3_EMENI | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dus3 PE=3 SV=1 | 11 | 238 | 5.0E-09 |
sp|A4RLF4|DUS3_MAGO7 | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DUS3 PE=3 SV=1 | 2 | 238 | 6.0E-09 |
sp|Q8CU07|DUS_STAES | Probable tRNA-dihydrouridine synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dus PE=3 SV=1 | 8 | 236 | 1.0E-08 |
sp|Q4P1U2|DUS3_USTMA | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DUS3 PE=3 SV=1 | 5 | 238 | 2.0E-08 |
sp|Q7SG01|DUS3_NEUCR | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dus-3 PE=3 SV=1 | 9 | 238 | 3.0E-08 |
sp|Q9I048|DUSA_PSEAE | tRNA-dihydrouridine(20/20a) synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dusA PE=3 SV=1 | 7 | 237 | 5.0E-08 |
sp|Q88KX0|DUSA_PSEPK | tRNA-dihydrouridine(20/20a) synthase OS=Pseudomonas putida (strain KT2440) GN=dusA PE=3 SV=1 | 7 | 239 | 7.0E-08 |
sp|O31546|DUS2_BACSU | Probable tRNA-dihydrouridine synthase 2 OS=Bacillus subtilis (strain 168) GN=dus2 PE=3 SV=1 | 5 | 236 | 8.0E-08 |
sp|Q9UTH9|DUS3_SCHPO | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus3 PE=3 SV=1 | 5 | 276 | 2.0E-07 |
sp|O27281|PYRDB_METTH | Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pyrD PE=3 SV=1 | 65 | 238 | 4.0E-07 |
sp|Q8PFF8|DUSA_XANAC | tRNA-dihydrouridine(20/20a) synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dusA PE=3 SV=1 | 6 | 236 | 5.0E-07 |
sp|A5DBS1|DUS3_PICGU | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DUS3 PE=3 SV=2 | 9 | 238 | 7.0E-07 |
sp|Q757E3|DUS3_ASHGO | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DUS3 PE=3 SV=1 | 7 | 239 | 2.0E-06 |
sp|Q6BS64|DUS3_DEBHA | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DUS3 PE=3 SV=1 | 9 | 239 | 2.0E-06 |
sp|A5DTS1|DUS3_LODEL | tRNA-dihydrouridine(47) synthase [NAD(P)(+)] OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DUS3 PE=3 SV=1 | 9 | 239 | 2.0E-06 |
sp|Q9HL35|PYRDB_THEAC | Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pyrD PE=3 SV=1 | 67 | 167 | 2.0E-06 |
Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
---|---|---|---|---|---|---|---|---|---|---|---|
Cytoplasm|Nucleus|Mitochondrion | Mitochondrial transit peptide | 0.7314 | 0.5421 | 0.0246 | 0.067 | 0.6769 | 0.0029 | 0.1482 | 0.2445 | 0.1342 | 0.0383 |
Expression values
Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
---|---|---|---|---|
Casing | Casing mycelium | 69.65 | 41.27 | 98.04 |
Initials | Initials knots | 75.61 | 44.91 | 106.30 |
Pileal_Stipeal_center | Stage I stipe center | 20.60 | 10.62 | 30.59 |
Pileal_Stipeal_shell | Stage I stipe shell | 13.87 | 6.90 | 20.83 |
DIF_stipe_center | Stage II stipe center | 23.06 | 12.22 | 33.90 |
DIF_stipe_shell | Stage II stipe shell | 15.46 | 7.68 | 23.24 |
DIF_stipe_skin | Stage II stipe skin | 21.82 | 11.21 | 32.42 |
DIF_cap_skin | Stage II cap skin | 16.58 | 8.43 | 24.72 |
DIF_cap_tissue | Stage II cap tissue | 11.56 | 5.57 | 17.56 |
DIF_gill_tissue | Stage II gill tissue | 10.96 | 5.25 | 16.67 |
YFB_stipe_center | Young fruiting body stipe center | 27.00 | 14.36 | 39.65 |
YFB_stipe_shell | Young fruiting body stipe shell | 28.01 | 15.23 | 40.79 |
YFB_stipe_skin | Young fruiting body stipe skin | 15.83 | 7.70 | 23.97 |
YFB_cap_skin | Young fruiting body cap skin | 29.58 | 16.26 | 42.90 |
YFB_cap_tissue | Young fruiting body cap tissue | 8.22 | 3.76 | 12.68 |
YFB_gill_tissue | Young fruiting body gill tissue | 20.75 | 10.42 | 31.08 |
YFB_veil | Young fruiting body veil | 10.33 | 4.94 | 15.73 |
Differential expression
Label1 | Label2 | Q-value | Significant difference |
---|---|---|---|
Casing | DIF_gill_tissue | 0.000613 | yes |
Casing | YFB_stipe_center | 0.001140 | yes |
Casing | YFB_stipe_shell | 0.001140 | yes |
Casing | YFB_stipe_skin | 0.000613 | yes |
Casing | YFB_cap_skin | 0.001140 | yes |
Casing | YFB_cap_tissue | 0.000613 | yes |
Casing | YFB_gill_tissue | 0.000613 | yes |
Casing | YFB_veil | 0.000613 | yes |
Casing | Initials | 0.869919 | no |
Casing | Pileal_Stipeal_center | 0.000613 | yes |
Casing | Pileal_Stipeal_shell | 0.000613 | yes |
Casing | DIF_stipe_center | 0.000613 | yes |
Casing | DIF_stipe_shell | 0.000613 | yes |
Casing | DIF_stipe_skin | 0.000613 | yes |
Casing | DIF_cap_skin | 0.000613 | yes |
Casing | DIF_cap_tissue | 0.000613 | yes |
DIF_gill_tissue | YFB_stipe_center | 0.007782 | yes |
DIF_gill_tissue | YFB_stipe_shell | 0.003765 | yes |
DIF_gill_tissue | YFB_stipe_skin | 0.394653 | no |
DIF_gill_tissue | YFB_cap_skin | 0.002084 | yes |
DIF_gill_tissue | YFB_cap_tissue | 0.546927 | no |
DIF_gill_tissue | YFB_gill_tissue | 0.070499 | no |
DIF_gill_tissue | YFB_veil | 0.930074 | no |
YFB_stipe_center | YFB_stipe_shell | 0.953044 | no |
YFB_stipe_center | YFB_stipe_skin | 0.130818 | no |
YFB_stipe_center | YFB_cap_skin | 0.871824 | no |
YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
YFB_stipe_center | YFB_gill_tissue | 0.553376 | no |
YFB_stipe_center | YFB_veil | 0.003365 | yes |
YFB_stipe_shell | YFB_stipe_skin | 0.097114 | no |
YFB_stipe_shell | YFB_cap_skin | 0.926632 | no |
YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
YFB_stipe_shell | YFB_gill_tissue | 0.468820 | no |
YFB_stipe_shell | YFB_veil | 0.002951 | yes |
YFB_stipe_skin | YFB_cap_skin | 0.063183 | no |
YFB_stipe_skin | YFB_cap_tissue | 0.080532 | no |
YFB_stipe_skin | YFB_gill_tissue | 0.565414 | no |
YFB_stipe_skin | YFB_veil | 0.290161 | no |
YFB_cap_skin | YFB_cap_tissue | 0.000613 | yes |
YFB_cap_skin | YFB_gill_tissue | 0.347737 | no |
YFB_cap_skin | YFB_veil | 0.002084 | yes |
YFB_cap_tissue | YFB_gill_tissue | 0.006742 | yes |
YFB_cap_tissue | YFB_veil | 0.661626 | no |
YFB_gill_tissue | YFB_veil | 0.037818 | yes |
Initials | DIF_gill_tissue | 0.000613 | yes |
Initials | YFB_stipe_center | 0.000613 | yes |
Initials | YFB_stipe_shell | 0.000613 | yes |
Initials | YFB_stipe_skin | 0.000613 | yes |
Initials | YFB_cap_skin | 0.000613 | yes |
Initials | YFB_cap_tissue | 0.000613 | yes |
Initials | YFB_gill_tissue | 0.000613 | yes |
Initials | YFB_veil | 0.000613 | yes |
Initials | Pileal_Stipeal_center | 0.000613 | yes |
Initials | Pileal_Stipeal_shell | 0.000613 | yes |
Initials | DIF_stipe_center | 0.000613 | yes |
Initials | DIF_stipe_shell | 0.000613 | yes |
Initials | DIF_stipe_skin | 0.000613 | yes |
Initials | DIF_cap_skin | 0.000613 | yes |
Initials | DIF_cap_tissue | 0.000613 | yes |
Pileal_Stipeal_center | DIF_gill_tissue | 0.063954 | no |
Pileal_Stipeal_center | YFB_stipe_center | 0.529634 | no |
Pileal_Stipeal_center | YFB_stipe_shell | 0.446193 | no |
Pileal_Stipeal_center | YFB_stipe_skin | 0.573210 | no |
Pileal_Stipeal_center | YFB_cap_skin | 0.325869 | no |
Pileal_Stipeal_center | YFB_cap_tissue | 0.003765 | yes |
Pileal_Stipeal_center | YFB_gill_tissue | 0.990867 | no |
Pileal_Stipeal_center | YFB_veil | 0.041603 | yes |
Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.307186 | no |
Pileal_Stipeal_center | DIF_stipe_center | 0.840367 | no |
Pileal_Stipeal_center | DIF_stipe_shell | 0.511724 | no |
Pileal_Stipeal_center | DIF_stipe_skin | 0.930624 | no |
Pileal_Stipeal_center | DIF_cap_skin | 0.638541 | no |
Pileal_Stipeal_center | DIF_cap_tissue | 0.106659 | no |
Pileal_Stipeal_shell | DIF_gill_tissue | 0.627233 | no |
Pileal_Stipeal_shell | YFB_stipe_center | 0.044201 | yes |
Pileal_Stipeal_shell | YFB_stipe_shell | 0.029890 | yes |
Pileal_Stipeal_shell | YFB_stipe_skin | 0.820852 | no |
Pileal_Stipeal_shell | YFB_cap_skin | 0.015529 | yes |
Pileal_Stipeal_shell | YFB_cap_tissue | 0.174631 | no |
Pileal_Stipeal_shell | YFB_gill_tissue | 0.302404 | no |
Pileal_Stipeal_shell | YFB_veil | 0.513401 | no |
Pileal_Stipeal_shell | DIF_stipe_center | 0.147956 | no |
Pileal_Stipeal_shell | DIF_stipe_shell | 0.854907 | no |
Pileal_Stipeal_shell | DIF_stipe_skin | 0.217760 | no |
Pileal_Stipeal_shell | DIF_cap_skin | 0.724243 | no |
Pileal_Stipeal_shell | DIF_cap_tissue | 0.735645 | no |
DIF_stipe_center | DIF_gill_tissue | 0.025205 | yes |
DIF_stipe_center | YFB_stipe_center | 0.753303 | no |
DIF_stipe_center | YFB_stipe_shell | 0.674881 | no |
DIF_stipe_center | YFB_stipe_skin | 0.347907 | no |
DIF_stipe_center | YFB_cap_skin | 0.546363 | no |
DIF_stipe_center | YFB_cap_tissue | 0.001140 | yes |
DIF_stipe_center | YFB_gill_tissue | 0.857866 | no |
DIF_stipe_center | YFB_veil | 0.015242 | yes |
DIF_stipe_center | DIF_stipe_shell | 0.288991 | no |
DIF_stipe_center | DIF_stipe_skin | 0.931726 | no |
DIF_stipe_center | DIF_cap_skin | 0.399915 | no |
DIF_stipe_center | DIF_cap_tissue | 0.040279 | yes |
DIF_stipe_shell | DIF_gill_tissue | 0.418605 | no |
DIF_stipe_shell | YFB_stipe_center | 0.106349 | no |
DIF_stipe_shell | YFB_stipe_shell | 0.077698 | no |
DIF_stipe_shell | YFB_stipe_skin | 0.972517 | no |
DIF_stipe_shell | YFB_cap_skin | 0.044201 | yes |
DIF_stipe_shell | YFB_cap_tissue | 0.087755 | no |
DIF_stipe_shell | YFB_gill_tissue | 0.511183 | no |
DIF_stipe_shell | YFB_veil | 0.317334 | no |
DIF_stipe_shell | DIF_stipe_skin | 0.399222 | no |
DIF_stipe_shell | DIF_cap_skin | 0.912527 | no |
DIF_stipe_shell | DIF_cap_tissue | 0.527828 | no |
DIF_stipe_skin | DIF_gill_tissue | 0.040279 | yes |
DIF_stipe_skin | YFB_stipe_center | 0.646128 | no |
DIF_stipe_skin | YFB_stipe_shell | 0.562299 | no |
DIF_stipe_skin | YFB_stipe_skin | 0.460105 | no |
DIF_stipe_skin | YFB_cap_skin | 0.432917 | no |
DIF_stipe_skin | YFB_cap_tissue | 0.002084 | yes |
DIF_stipe_skin | YFB_gill_tissue | 0.939568 | no |
DIF_stipe_skin | YFB_veil | 0.024444 | yes |
DIF_stipe_skin | DIF_cap_skin | 0.519276 | no |
DIF_stipe_skin | DIF_cap_tissue | 0.066395 | no |
DIF_cap_skin | DIF_gill_tissue | 0.279565 | no |
DIF_cap_skin | YFB_stipe_center | 0.151524 | no |
DIF_cap_skin | YFB_stipe_shell | 0.109462 | no |
DIF_cap_skin | YFB_stipe_skin | 0.945318 | no |
DIF_cap_skin | YFB_cap_skin | 0.061662 | no |
DIF_cap_skin | YFB_cap_tissue | 0.044418 | yes |
DIF_cap_skin | YFB_gill_tissue | 0.634422 | no |
DIF_cap_skin | YFB_veil | 0.195928 | no |
DIF_cap_skin | DIF_cap_tissue | 0.378960 | no |
DIF_cap_tissue | DIF_gill_tissue | 0.938363 | no |
DIF_cap_tissue | YFB_stipe_center | 0.008121 | yes |
DIF_cap_tissue | YFB_stipe_shell | 0.006387 | yes |
DIF_cap_tissue | YFB_stipe_skin | 0.493720 | no |
DIF_cap_tissue | YFB_cap_skin | 0.002951 | yes |
DIF_cap_tissue | YFB_cap_tissue | 0.452750 | no |
DIF_cap_tissue | YFB_gill_tissue | 0.103148 | no |
DIF_cap_tissue | YFB_veil | 0.854771 | no |
Orthofinder run ID | 1 |
Orthogroup | 6915 |
Change Orthofinder run |
Species | Protein ID |
---|---|
Agaricus bisporus var bisporus H39 | AgabiH39|111250 |
Agaricus bisporus var bisporus H97 | AgabiH97|111250 (this protein) |
Rhodonia placenta FPRL280 | RhoplFPRL280|109_12 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|111250 MDRNRLKFIAAPMVGQSDLPFRVLTRKNNATLAYTQMLMSTKLLSDQEYLETHLKDLSTVVSGLENPVVAQLCGN DPDAIVQAGRKLQNYCQGIDLNLGCPQGLARDGHYGAYLLGQSDWSLVESIVSSMAQSFTVPVSVKTRLCQPQVK TLELYQRLEHCGASWLILHGRTISARRRRQGSADLTEVKRLKENLSIPIISNGNVRGHNDIWENLAFTGADGLMV GETLLGNPYVFTETLPDPVDISFEYLSLCHQYPGIASLQAIQTHVRHFIEFQCGRETWFSKFRTALSATRSIEDI EHLVYLKLERWRGRKSRYLSDCWENQDKDSTSSSESDHSDLSAGDLDLLTMP* |
Coding | >AgabiH97|111250 ATGGACAGAAACCGCCTCAAGTTTATCGCGGCACCAATGGTCGGCCAATCAGATCTACCCTTCCGTGTCCTTACT CGCAAAAATAACGCTACCCTAGCCTACACCCAGATGCTAATGTCTACCAAGCTGCTGAGCGATCAAGAATACCTC GAAACCCACCTCAAAGATCTGTCCACTGTTGTTTCTGGGCTTGAGAATCCCGTTGTCGCCCAATTATGCGGCAAC GATCCCGATGCAATTGTCCAGGCTGGGCGCAAATTGCAGAATTACTGCCAAGGAATAGACCTCAACCTTGGTTGC CCTCAAGGCCTCGCGAGAGATGGTCACTATGGTGCCTACTTGTTGGGACAAAGTGATTGGTCTCTCGTAGAATCG ATAGTCTCTTCAATGGCGCAGTCTTTCACGGTCCCTGTATCAGTGAAAACGAGACTGTGCCAGCCTCAAGTGAAG ACACTAGAGCTCTATCAGAGACTCGAACATTGTGGGGCCTCATGGCTGATCCTACATGGGCGTACTATTTCTGCT CGAAGACGTCGACAAGGATCTGCTGACCTTACCGAAGTCAAACGGCTCAAGGAAAACCTGTCTATTCCAATCATC AGTAACGGAAATGTGCGCGGACATAACGATATCTGGGAAAATTTGGCATTCACTGGCGCTGATGGCCTCATGGTC GGCGAGACCTTACTTGGAAATCCCTACGTTTTTACCGAAACTTTACCAGATCCCGTTGATATATCATTCGAGTAT CTTTCCCTGTGCCACCAGTATCCTGGTATTGCTTCTCTCCAAGCAATACAGACCCACGTACGACACTTCATTGAA TTCCAATGTGGTAGGGAAACGTGGTTCAGCAAATTTAGAACTGCGCTATCTGCCACAAGATCTATCGAAGACATC GAGCATCTTGTTTATCTCAAACTGGAACGTTGGCGAGGGCGGAAGTCCAGATATCTATCAGACTGCTGGGAAAAC CAGGATAAAGATAGCACTAGTTCAAGCGAAAGTGACCATTCGGATCTTTCGGCAGGAGATTTAGATTTACTCACT ATGCCATGA |
Transcript | >AgabiH97|111250 ATGGACAGAAACCGCCTCAAGTTTATCGCGGCACCAATGGTCGGCCAATCAGATCTACCCTTCCGTGTCCTTACT CGCAAAAATAACGCTACCCTAGCCTACACCCAGATGCTAATGTCTACCAAGCTGCTGAGCGATCAAGAATACCTC GAAACCCACCTCAAAGATCTGTCCACTGTTGTTTCTGGGCTTGAGAATCCCGTTGTCGCCCAATTATGCGGCAAC GATCCCGATGCAATTGTCCAGGCTGGGCGCAAATTGCAGAATTACTGCCAAGGAATAGACCTCAACCTTGGTTGC CCTCAAGGCCTCGCGAGAGATGGTCACTATGGTGCCTACTTGTTGGGACAAAGTGATTGGTCTCTCGTAGAATCG ATAGTCTCTTCAATGGCGCAGTCTTTCACGGTCCCTGTATCAGTGAAAACGAGACTGTGCCAGCCTCAAGTGAAG ACACTAGAGCTCTATCAGAGACTCGAACATTGTGGGGCCTCATGGCTGATCCTACATGGGCGTACTATTTCTGCT CGAAGACGTCGACAAGGATCTGCTGACCTTACCGAAGTCAAACGGCTCAAGGAAAACCTGTCTATTCCAATCATC AGTAACGGAAATGTGCGCGGACATAACGATATCTGGGAAAATTTGGCATTCACTGGCGCTGATGGCCTCATGGTC GGCGAGACCTTACTTGGAAATCCCTACGTTTTTACCGAAACTTTACCAGATCCCGTTGATATATCATTCGAGTAT CTTTCCCTGTGCCACCAGTATCCTGGTATTGCTTCTCTCCAAGCAATACAGACCCACGTACGACACTTCATTGAA TTCCAATGTGGTAGGGAAACGTGGTTCAGCAAATTTAGAACTGCGCTATCTGCCACAAGATCTATCGAAGACATC GAGCATCTTGTTTATCTCAAACTGGAACGTTGGCGAGGGCGGAAGTCCAGATATCTATCAGACTGCTGGGAAAAC CAGGATAAAGATAGCACTAGTTCAAGCGAAAGTGACCATTCGGATCTTTCGGCAGGAGATTTAGATTTACTCACT ATGCCATGA |
Gene | >AgabiH97|111250 ATGGACAGAAACCGCCTCAAGTTTATCGCGGCACCAATGGTCGGCCAATCAGATCTACCCTTCCGTGTCCTTACT CGCAAAAATAACGCTACCCTAGCCTACACCCAGATGCTAATGTCTACCAAGCTGCTGAGCGATCAAGAATACCTC GAAACCCACCTCAAAGATCTGTCCACTGTTGTTTCTGGGCTTGAGAATCCCGTTGTCGCCCAATTATGCGGCAAC GATCCCGATGCAATTGTCCAGGCTGGGCGCAAATTGCAGAATTACTGCCAAGGAATAGGTACCTAATGCCTGCTC AGTATCTGACTTGCTCGTACACGTACCAAAGATGAGTAGACCTCAACCTTGGTTGCCCTCAAGGCCTCGCGAGAG ATGGTCACTATGGTGCCTACTTGTTGGGACAAAGTGATTGGTCTCTCGTAGAATCGATAGGTCTGAATCTCCAAG TGTACTGGGTGATCGGCTGACTGGGATCCTTAGTCTCTTCAATGGCGCAGTCTTTCACGGTCCCTGTATCAGTGA AAACGAGACTGTGCCAGCCTCAAGTGAAGACACTAGAGCTCTATCAGAGACTCGAACATTGTGGGGCCTCATGGC TGATCCTACATGGGCGTACTATTTCTGCTCGAAGACGTCGACAAGGATCTGCTGACCTTACCGAAGTCAAACGGC TCAAGGAAAACCTGTCTATTCCAATCATCAGTAACGGAAATGTGCGCGGACATAACGATATCTGGGAAAATTTGG CATTCACTGGCGCTGATGGCCTCATGGTCGGCGAGACCTTACTTGGAAATCCCTAGTATGTCTTCTTGTGGTGAC TAAGGCCCCTTTTTGTGACGCAATATTCAGCGTTTTTACCGAAACTTTACCAGATCCCGTTGATATATCATTCGA GTATCTTTCCCTGTGCCACCAGTATCCTGGTATTGCTTCTCTCCAAGCAATACAGACCCACGTACGACACTTCAT TGAATTCCAATGGTATGGTTGGCACTTTGACTTTCTCGCAAACTCCCGGTTCACTATCTCCAGTGGTAGGGAAAC GTGGTTCAGCAAATTTAGAACTGCGCTATCTGCCACAAGATCTATCGAAGACATCGAGCATCTTGTTTATCTCAA ACTGGAACGTTGGCGAGGGCGGAAGTCCAGATATCTATCAGACTGCTGGGAAAACCAGGATAAAGATAGCACTAG TTCAAGCGAAAGTGACCATTCGGATCTTTCGGCAGGAGATTTAGATTTACTCACTATGCCATGA |