Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|111090
Gene name
Locationscaffold_8:1289591..1290892
Strand-
Gene length (bp)1301
Transcript length (bp)900
Coding sequence length (bp)900
Protein length (aa) 300

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04321 RmlD_sub_bind RmlD substrate binding domain 1.1E-54 4 277
PF01370 Epimerase NAD dependent epimerase/dehydratase family 4.2E-23 5 212
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 1.2E-06 6 159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q566L8|MAT2B_XENTR Methionine adenosyltransferase 2 subunit beta OS=Xenopus tropicalis GN=mat2b PE=2 SV=1 3 279 2.0E-67
sp|Q29RI9|MAT2B_BOVIN Methionine adenosyltransferase 2 subunit beta OS=Bos taurus GN=MAT2B PE=2 SV=1 3 279 5.0E-66
sp|Q4QQZ4|MAT2B_XENLA Methionine adenosyltransferase 2 subunit beta OS=Xenopus laevis GN=mat2b PE=2 SV=1 3 279 5.0E-66
sp|Q5U2R0|MAT2B_RAT Methionine adenosyltransferase 2 subunit beta OS=Rattus norvegicus GN=Mat2b PE=2 SV=1 3 279 9.0E-66
sp|Q5R4E0|MAT2B_PONAB Methionine adenosyltransferase 2 subunit beta OS=Pongo abelii GN=MAT2B PE=2 SV=1 3 279 9.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q566L8|MAT2B_XENTR Methionine adenosyltransferase 2 subunit beta OS=Xenopus tropicalis GN=mat2b PE=2 SV=1 3 279 2.0E-67
sp|Q29RI9|MAT2B_BOVIN Methionine adenosyltransferase 2 subunit beta OS=Bos taurus GN=MAT2B PE=2 SV=1 3 279 5.0E-66
sp|Q4QQZ4|MAT2B_XENLA Methionine adenosyltransferase 2 subunit beta OS=Xenopus laevis GN=mat2b PE=2 SV=1 3 279 5.0E-66
sp|Q5U2R0|MAT2B_RAT Methionine adenosyltransferase 2 subunit beta OS=Rattus norvegicus GN=Mat2b PE=2 SV=1 3 279 9.0E-66
sp|Q5R4E0|MAT2B_PONAB Methionine adenosyltransferase 2 subunit beta OS=Pongo abelii GN=MAT2B PE=2 SV=1 3 279 9.0E-66
sp|Q9NZL9|MAT2B_HUMAN Methionine adenosyltransferase 2 subunit beta OS=Homo sapiens GN=MAT2B PE=1 SV=1 3 279 9.0E-66
sp|Q99LB6|MAT2B_MOUSE Methionine adenosyltransferase 2 subunit beta OS=Mus musculus GN=Mat2b PE=1 SV=1 3 279 1.0E-65
sp|Q5BJJ6|MAT2B_DANRE Methionine adenosyltransferase 2 subunit beta OS=Danio rerio GN=mat2b PE=2 SV=1 3 279 9.0E-62
sp|Q9L9E9|NOVS_STRNV dTDP-4-keto-6-deoxy-D-glucose reductase OS=Streptomyces niveus GN=novS PE=3 SV=1 3 283 3.0E-23
sp|D4GU71|AGL14_HALVD Probable low-salt glycan biosynthesis reductase Agl14 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=agl14 PE=3 SV=1 4 168 4.0E-23
sp|P29781|RMLD_STRGR dTDP-4-dehydrorhamnose reductase OS=Streptomyces griseus GN=strL PE=1 SV=1 3 184 6.0E-21
sp|P39631|SPSK_BACSU Spore coat polysaccharide biosynthesis protein SpsK OS=Bacillus subtilis (strain 168) GN=spsK PE=3 SV=3 1 233 5.0E-19
sp|A0QTF8|RMLD_MYCS2 dTDP-4-dehydrorhamnose reductase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rmlD PE=1 SV=1 3 223 9.0E-18
sp|P9WH09|RMLD_MYCTU dTDP-4-dehydrorhamnose reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rmlD PE=1 SV=1 3 184 4.0E-16
sp|P9WH08|RMLD_MYCTO dTDP-4-dehydrorhamnose reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rmlD PE=3 SV=1 3 184 4.0E-16
sp|O66251|RMLD_AGGAC dTDP-4-dehydrorhamnose reductase OS=Aggregatibacter actinomycetemcomitans GN=rmlD PE=1 SV=1 1 280 9.0E-15
sp|Q2SYI1|RMLD_BURTA dTDP-4-dehydrorhamnose reductase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rmlD PE=1 SV=1 2 203 7.0E-12
sp|P26392|RMLD_SALTY dTDP-4-dehydrorhamnose reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rfbD PE=1 SV=1 5 205 1.0E-11
sp|P37760|RMLD_ECOLI dTDP-4-dehydrorhamnose reductase OS=Escherichia coli (strain K12) GN=rfbD PE=3 SV=2 44 205 2.0E-10
sp|P37778|RMLD_SHIFL dTDP-4-dehydrorhamnose reductase OS=Shigella flexneri GN=rfbD PE=1 SV=2 44 205 2.0E-10
sp|Q46769|RMLD_ECOLX dTDP-4-dehydrorhamnose reductase OS=Escherichia coli GN=rfbD PE=1 SV=1 44 184 6.0E-10
sp|P55463|RMLD_RHISN Probable dTDP-4-dehydrorhamnose reductase OS=Rhizobium sp. (strain NGR234) GN=NGR_a03570 PE=3 SV=1 2 203 5.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|111090
MVKAIVTGASGVLGSAIYKALKKANHSVVGLSYTKKAEGLLQLDLTDSNAVQFLIQYQRPDWLIHCAAERRPDVA
EKDPQGTQRLNGEVPGHLASLAANFGFTLVYISTDYVFDGTAPPYGPDSAPNPLQLYGKSKRDGELAISAVTGAK
SVIIRVPVLYGPTPKNSDSAINTLLDVVQDQSGKQYKMDHYATRYPTNVEDIAGFLTRVIDSRQSLPRILHYSAD
EPFTKYEICLIFAKILDVPHSHIIPDPNPPIGEGATTRPRDCHLFTKETEDLGIEGGLGLSLFEEWWTDRLKQK*
Coding >AgabiH97|111090
ATGGTCAAGGCAATTGTCACCGGAGCTTCTGGGGTACTCGGATCGGCGATCTACAAAGCACTCAAAAAGGCCAAC
CATTCAGTCGTCGGACTTTCCTATACGAAGAAGGCTGAAGGGTTGCTTCAGCTTGATCTGACAGATAGCAACGCG
GTCCAATTTTTGATCCAATATCAACGTCCTGACTGGCTCATTCACTGTGCGGCGGAACGACGCCCCGACGTAGCA
GAAAAAGATCCTCAGGGGACGCAACGACTCAATGGGGAGGTCCCAGGTCATCTTGCTTCTCTTGCCGCGAACTTT
GGCTTTACATTGGTGTACATTTCTACTGATTACGTTTTCGATGGAACCGCTCCCCCTTACGGGCCCGATTCTGCA
CCCAACCCCTTGCAACTGTACGGGAAATCTAAGAGAGACGGAGAGCTCGCTATATCCGCAGTGACTGGCGCAAAA
TCCGTCATAATCAGAGTTCCTGTATTATACGGTCCGACACCCAAGAACTCTGATTCGGCTATTAACACGCTGCTC
GACGTTGTCCAAGATCAGTCTGGAAAACAGTACAAGATGGACCACTACGCTACTAGATATCCTACGAATGTTGAA
GATATCGCGGGATTTTTAACCCGTGTTATAGATTCACGGCAGTCGCTTCCACGTATCTTGCACTATAGTGCTGAT
GAACCGTTTACCAAATACGAAATTTGCTTGATTTTCGCAAAAATACTTGATGTACCCCACTCTCACATCATCCCA
GATCCCAATCCACCGATCGGAGAAGGCGCAACAACACGTCCGAGGGACTGTCACTTGTTTACCAAGGAGACCGAA
GATTTAGGCATTGAAGGTGGACTCGGCCTTTCACTCTTCGAAGAATGGTGGACGGACCGCTTGAAACAAAAATAA
Transcript >AgabiH97|111090
ATGGTCAAGGCAATTGTCACCGGAGCTTCTGGGGTACTCGGATCGGCGATCTACAAAGCACTCAAAAAGGCCAAC
CATTCAGTCGTCGGACTTTCCTATACGAAGAAGGCTGAAGGGTTGCTTCAGCTTGATCTGACAGATAGCAACGCG
GTCCAATTTTTGATCCAATATCAACGTCCTGACTGGCTCATTCACTGTGCGGCGGAACGACGCCCCGACGTAGCA
GAAAAAGATCCTCAGGGGACGCAACGACTCAATGGGGAGGTCCCAGGTCATCTTGCTTCTCTTGCCGCGAACTTT
GGCTTTACATTGGTGTACATTTCTACTGATTACGTTTTCGATGGAACCGCTCCCCCTTACGGGCCCGATTCTGCA
CCCAACCCCTTGCAACTGTACGGGAAATCTAAGAGAGACGGAGAGCTCGCTATATCCGCAGTGACTGGCGCAAAA
TCCGTCATAATCAGAGTTCCTGTATTATACGGTCCGACACCCAAGAACTCTGATTCGGCTATTAACACGCTGCTC
GACGTTGTCCAAGATCAGTCTGGAAAACAGTACAAGATGGACCACTACGCTACTAGATATCCTACGAATGTTGAA
GATATCGCGGGATTTTTAACCCGTGTTATAGATTCACGGCAGTCGCTTCCACGTATCTTGCACTATAGTGCTGAT
GAACCGTTTACCAAATACGAAATTTGCTTGATTTTCGCAAAAATACTTGATGTACCCCACTCTCACATCATCCCA
GATCCCAATCCACCGATCGGAGAAGGCGCAACAACACGTCCGAGGGACTGTCACTTGTTTACCAAGGAGACCGAA
GATTTAGGCATTGAAGGTGGACTCGGCCTTTCACTCTTCGAAGAATGGTGGACGGACCGCTTGAAACAAAAATAA
Gene >AgabiH97|111090
ATGGTCAAGGCAATTGTCACCGGTAATTTTGTCGCTATCGGCCCCGTATCCAGTCTCACTGACGGTTTTGACAGG
AGCTTCTGGGGTACTCGGATCGGCGATCTACAAAGCACTCAAAAAGGCCAACCATTCAGTCGTCGGACTTTCCTA
TACGAAGAAGGCTGAAGGGTTGCTTCAGCTTGATCTGACAGATAGCAACGCGGTCCAATTTTTGATCCAATATCA
ACGTCCTGACTGTGGGTTTCCCTGGAATTTATGCAACCTCAGTGACATTTCAGTTCTCACAAGGTTCAATTTCCA
GGGCTCATTCACTGTGCGGCGGAACGACGCCCCGACGTAGCAGAAAAAGCGAGTCTTTCGGTCAAAAACAATGAA
CGCGTCTCTGATGCATATTTCTAGGATCCTCAGGGGACGCAACGAGTAAGGAAACAAAAGCACACTCCGCTTATC
GTAATTTTTGAAATTTGAAACAATTTTAGCTCAATGGGGAGGTCCCAGGTCATCTTGCTTCTCTTGCCGCGAACT
TTGGCTTTACATTGGTGTACATTTCTACTGGTAAGATGTCCTAAACCATCTCACGCCCGCAGGAAAAAGAGTCAA
TACTATGATGATCAGATTACGTTTTCGATGGAACCGCTCCCCCTTACGGGCCCGATTCTGCACCCAACCCCTTGC
AACTGTACGGGAAATCTAAGAGAGACGGAGAGCTCGCTATATCCGCAGTGACTGGCGCAAAATCCGTCATAATCA
GAGTTCCTGTATTGTCTGTCCTACTTTGTCCGCTTCCCTCGGATTATTGTCCAAGTAACACGAAATCACTAGATA
CGGTCCGACACCCAAGAACTCTGATTCGGCTATTAACACGCTGCTCGACGTTGTCCAAGATCAGTCTGGAAAACA
GTACAAGATGGACCACTACGCTACTAGATATCCTACGAATGTTGAAGATATCGCGGGATTTTTAACCCGTGTTAT
AGGTATGCTTCAACATAACCATGTCCCTTGTCATCTCGTCCGCTCAAAAGCCAATAGATTCACGGCAGTCGCTTC
CACGTATCTTGCACTATAGTGCTGATGAACCGTTTACCAAATACGAAATTTGCTTGATTTTCGCAAAAATACTTG
ATGTACCCCACTCTCACATCATCCCAGATCCCAATCCACCGATCGGAGAAGGCGCAACAACACGTCCGAGGGACT
GTCACTTGTTTACCAAGGAGACCGAAGATTTAGGCATTGAAGGTGGACTCGGCCTTTCACTCTTCGAAGAATGGT
GGACGGACCGCTTGAAACAAAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail