Protein ID | AgabiH97|111050 |
Gene name | |
Location | scaffold_8:1283017..1284028 |
Strand | - |
Gene length (bp) | 1011 |
Transcript length (bp) | 825 |
Coding sequence length (bp) | 825 |
Protein length (aa) | 275 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00075 | RNase_H | RNase H | 8.3E-26 | 111 | 263 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q5BK46|RNH1_RAT | Ribonuclease H1 OS=Rattus norvegicus GN=Rnaseh1 PE=2 SV=1 | 110 | 267 | 2.0E-24 |
sp|O70338|RNH1_MOUSE | Ribonuclease H1 OS=Mus musculus GN=Rnaseh1 PE=2 SV=1 | 110 | 267 | 5.0E-24 |
sp|O60930|RNH1_HUMAN | Ribonuclease H1 OS=Homo sapiens GN=RNASEH1 PE=1 SV=2 | 112 | 267 | 7.0E-22 |
sp|A4IYE6|RNH_FRATW | Ribonuclease H OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rnhA PE=3 SV=1 | 107 | 265 | 3.0E-15 |
sp|Q0BMB7|RNH_FRATO | Ribonuclease H OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rnhA PE=3 SV=1 | 107 | 265 | 3.0E-15 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q5BK46|RNH1_RAT | Ribonuclease H1 OS=Rattus norvegicus GN=Rnaseh1 PE=2 SV=1 | 110 | 267 | 2.0E-24 |
sp|O70338|RNH1_MOUSE | Ribonuclease H1 OS=Mus musculus GN=Rnaseh1 PE=2 SV=1 | 110 | 267 | 5.0E-24 |
sp|O60930|RNH1_HUMAN | Ribonuclease H1 OS=Homo sapiens GN=RNASEH1 PE=1 SV=2 | 112 | 267 | 7.0E-22 |
sp|A4IYE6|RNH_FRATW | Ribonuclease H OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rnhA PE=3 SV=1 | 107 | 265 | 3.0E-15 |
sp|Q0BMB7|RNH_FRATO | Ribonuclease H OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rnhA PE=3 SV=1 | 107 | 265 | 3.0E-15 |
sp|A0Q6W0|RNH_FRATN | Ribonuclease H OS=Francisella tularensis subsp. novicida (strain U112) GN=rnhA PE=3 SV=1 | 107 | 265 | 3.0E-15 |
sp|B2SFV9|RNH_FRATM | Ribonuclease H OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rnhA PE=3 SV=1 | 107 | 265 | 3.0E-15 |
sp|Q2A3X6|RNH_FRATH | Ribonuclease H OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rnhA PE=3 SV=1 | 107 | 265 | 3.0E-15 |
sp|A7NBM9|RNH_FRATF | Ribonuclease H OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rnhA PE=3 SV=1 | 107 | 265 | 3.0E-15 |
sp|Q14IN1|RNH_FRAT1 | Ribonuclease H OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rnhA PE=3 SV=2 | 107 | 265 | 3.0E-15 |
sp|B0TZ91|RNH_FRAP2 | Ribonuclease H OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rnhA PE=3 SV=1 | 104 | 265 | 9.0E-15 |
sp|B6JJ39|RNH_OLICO | Ribonuclease H OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rnhA PE=3 SV=1 | 111 | 265 | 4.0E-14 |
sp|Q74BH0|RNH_GEOSL | Ribonuclease H OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rnhA PE=3 SV=1 | 109 | 263 | 4.0E-14 |
sp|Q985W1|RNH_RHILO | Ribonuclease H OS=Rhizobium loti (strain MAFF303099) GN=rnhA PE=3 SV=1 | 109 | 264 | 5.0E-14 |
sp|A5G5F6|RNH_GEOUR | Ribonuclease H OS=Geobacter uraniireducens (strain Rf4) GN=rnhA PE=3 SV=1 | 112 | 263 | 6.0E-14 |
sp|Q1QH30|RNH_NITHX | Ribonuclease H OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rnhA PE=3 SV=1 | 111 | 264 | 7.0E-14 |
sp|Q3A827|RNH_PELCD | Ribonuclease H OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rnhA PE=3 SV=1 | 112 | 269 | 9.0E-14 |
sp|A5UFU3|RNH_HAEIG | Ribonuclease H OS=Haemophilus influenzae (strain PittGG) GN=rnhA PE=3 SV=1 | 109 | 272 | 1.0E-13 |
sp|Q4QP49|RNH_HAEI8 | Ribonuclease H OS=Haemophilus influenzae (strain 86-028NP) GN=rnhA PE=3 SV=1 | 109 | 272 | 1.0E-13 |
sp|A0LGJ7|RNH_SYNFM | Ribonuclease H OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rnhA PE=3 SV=1 | 110 | 263 | 2.0E-13 |
sp|Q3SP51|RNH_NITWN | Ribonuclease H OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rnhA PE=3 SV=1 | 111 | 264 | 2.0E-13 |
sp|A4Z216|RNH_BRASO | Ribonuclease H OS=Bradyrhizobium sp. (strain ORS278) GN=rnhA PE=3 SV=1 | 112 | 264 | 3.0E-13 |
sp|P43807|RNH_HAEIN | Ribonuclease HI OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rnhA PE=3 SV=1 | 110 | 272 | 3.0E-13 |
sp|A3MZE1|RNH_ACTP2 | Ribonuclease H OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rnhA PE=3 SV=1 | 112 | 260 | 4.0E-13 |
sp|Q0AE34|RNH_NITEC | Ribonuclease H OS=Nitrosomonas eutropha (strain C91) GN=rnhA PE=3 SV=1 | 105 | 263 | 4.0E-13 |
sp|A5EXP9|RNH_DICNV | Ribonuclease H OS=Dichelobacter nodosus (strain VCS1703A) GN=rnhA PE=3 SV=1 | 114 | 263 | 1.0E-12 |
sp|A5EAL2|RNH_BRASB | Ribonuclease H OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rnhA PE=3 SV=1 | 112 | 264 | 1.0E-12 |
sp|B5Y1G2|RNH_KLEP3 | Ribonuclease H OS=Klebsiella pneumoniae (strain 342) GN=rnhA PE=3 SV=1 | 110 | 272 | 1.0E-12 |
sp|P0A2B9|RNH_SALTY | Ribonuclease HI OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rnhA PE=3 SV=1 | 110 | 273 | 1.0E-12 |
sp|P0A2C0|RNH_SALTI | Ribonuclease HI OS=Salmonella typhi GN=rnhA PE=3 SV=1 | 110 | 273 | 1.0E-12 |
sp|B4TYH0|RNH_SALSV | Ribonuclease H OS=Salmonella schwarzengrund (strain CVM19633) GN=rnhA PE=3 SV=1 | 110 | 273 | 1.0E-12 |
sp|B5BDW5|RNH_SALPK | Ribonuclease H OS=Salmonella paratyphi A (strain AKU_12601) GN=rnhA PE=3 SV=1 | 110 | 273 | 1.0E-12 |
sp|A9MZ19|RNH_SALPB | Ribonuclease H OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rnhA PE=3 SV=1 | 110 | 273 | 1.0E-12 |
sp|Q5PFD8|RNH_SALPA | Ribonuclease H OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rnhA PE=3 SV=1 | 110 | 273 | 1.0E-12 |
sp|B4SV39|RNH_SALNS | Ribonuclease H OS=Salmonella newport (strain SL254) GN=rnhA PE=3 SV=1 | 110 | 273 | 1.0E-12 |
sp|B4TK85|RNH_SALHS | Ribonuclease H OS=Salmonella heidelberg (strain SL476) GN=rnhA PE=3 SV=1 | 110 | 273 | 1.0E-12 |
sp|B5R5L3|RNH_SALG2 | Ribonuclease H OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rnhA PE=3 SV=1 | 110 | 273 | 1.0E-12 |
sp|B5R449|RNH_SALEP | Ribonuclease H OS=Salmonella enteritidis PT4 (strain P125109) GN=rnhA PE=3 SV=1 | 110 | 273 | 1.0E-12 |
sp|B5FJ58|RNH_SALDC | Ribonuclease H OS=Salmonella dublin (strain CT_02021853) GN=rnhA PE=3 SV=1 | 110 | 273 | 1.0E-12 |
sp|Q57SZ6|RNH_SALCH | Ribonuclease H OS=Salmonella choleraesuis (strain SC-B67) GN=rnhA PE=3 SV=2 | 110 | 273 | 1.0E-12 |
sp|A9MPF1|RNH_SALAR | Ribonuclease H OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rnhA PE=3 SV=1 | 110 | 273 | 1.0E-12 |
sp|B5F8X2|RNH_SALA4 | Ribonuclease H OS=Salmonella agona (strain SL483) GN=rnhA PE=3 SV=1 | 110 | 273 | 1.0E-12 |
sp|A4W6V4|RNH_ENT38 | Ribonuclease H OS=Enterobacter sp. (strain 638) GN=rnhA PE=3 SV=1 | 109 | 265 | 1.0E-12 |
sp|Q5F7K9|RNH_NEIG1 | Ribonuclease H OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rnhA PE=3 SV=1 | 112 | 264 | 2.0E-12 |
sp|A7MY21|RNH_VIBCB | Ribonuclease H OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rnhA PE=3 SV=1 | 109 | 273 | 2.0E-12 |
sp|C0Q6N2|RNH_SALPC | Ribonuclease H OS=Salmonella paratyphi C (strain RKS4594) GN=rnhA PE=3 SV=1 | 110 | 273 | 2.0E-12 |
sp|A6VMP9|RNH_ACTSZ | Ribonuclease H OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rnhA PE=3 SV=1 | 110 | 273 | 2.0E-12 |
sp|Q0AMI4|RNH_MARMM | Ribonuclease H OS=Maricaulis maris (strain MCS10) GN=rnhA PE=3 SV=1 | 112 | 265 | 2.0E-12 |
sp|Q82XV8|RNH_NITEU | Ribonuclease H OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rnhA PE=3 SV=1 | 112 | 272 | 2.0E-12 |
sp|Q493H7|RNH_BLOPB | Ribonuclease H OS=Blochmannia pennsylvanicus (strain BPEN) GN=rnhA PE=3 SV=1 | 112 | 263 | 2.0E-12 |
sp|O69014|RNH_ZYMMO | Ribonuclease H OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rnhA PE=3 SV=1 | 112 | 263 | 3.0E-12 |
sp|A6T512|RNH_KLEP7 | Ribonuclease H OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rnhA PE=3 SV=1 | 110 | 264 | 3.0E-12 |
sp|A4SPI4|RNH_AERS4 | Ribonuclease H OS=Aeromonas salmonicida (strain A449) GN=rnhA PE=3 SV=1 | 110 | 271 | 3.0E-12 |
sp|C0R2X2|RNH_WOLWR | Ribonuclease H OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=rnhA PE=3 SV=1 | 110 | 265 | 3.0E-12 |
sp|Q2G9E3|RNH_NOVAD | Ribonuclease H OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rnhA PE=3 SV=1 | 110 | 263 | 3.0E-12 |
sp|Q73K21|RNH_TREDE | Ribonuclease H OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rnhA PE=3 SV=1 | 111 | 263 | 3.0E-12 |
sp|Q9JYE5|RNH_NEIMB | Ribonuclease HI OS=Neisseria meningitidis serogroup B (strain MC58) GN=rnhA PE=3 SV=1 | 109 | 264 | 4.0E-12 |
sp|Q8DM24|RNH_THEEB | Ribonuclease H OS=Thermosynechococcus elongatus (strain BP-1) GN=rnhA PE=3 SV=1 | 113 | 234 | 4.0E-12 |
sp|B0TRM1|RNH_SHEHH | Ribonuclease H OS=Shewanella halifaxensis (strain HAW-EB4) GN=rnhA PE=3 SV=1 | 110 | 273 | 4.0E-12 |
sp|Q87MG2|RNH_VIBPA | Ribonuclease HI OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnhA PE=3 SV=1 | 109 | 273 | 4.0E-12 |
sp|Q9JTD9|RNH_NEIMA | Ribonuclease HI OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rnhA PE=3 SV=1 | 109 | 264 | 4.0E-12 |
sp|Q31H49|RNH_THICR | Ribonuclease H OS=Thiomicrospira crunogena (strain XCL-2) GN=rnhA PE=3 SV=1 | 110 | 263 | 4.0E-12 |
sp|B6EJV2|RNH_ALISL | Ribonuclease H OS=Aliivibrio salmonicida (strain LFI1238) GN=rnhA PE=3 SV=1 | 110 | 273 | 4.0E-12 |
sp|A1KV38|RNH_NEIMF | Ribonuclease H OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rnhA PE=3 SV=1 | 112 | 264 | 5.0E-12 |
sp|Q1MKH6|RNH_RHIL3 | Ribonuclease H OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rnhA PE=3 SV=1 | 110 | 263 | 6.0E-12 |
sp|Q2KBL2|RNH_RHIEC | Ribonuclease H OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rnhA PE=3 SV=1 | 110 | 263 | 6.0E-12 |
sp|Q92RG0|RNH_RHIME | Ribonuclease H OS=Rhizobium meliloti (strain 1021) GN=rnhA PE=3 SV=1 | 110 | 263 | 8.0E-12 |
sp|A7MI34|RNH_CROS8 | Ribonuclease H OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rnhA PE=3 SV=1 | 110 | 263 | 8.0E-12 |
sp|Q7N807|RNH_PHOLL | Ribonuclease H OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rnhA PE=3 SV=1 | 109 | 271 | 8.0E-12 |
sp|A1S6T0|RNH_SHEAM | Ribonuclease H OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rnhA PE=3 SV=1 | 110 | 271 | 9.0E-12 |
sp|Q7VQB6|RNH_BLOFL | Ribonuclease H OS=Blochmannia floridanus GN=rnhA PE=3 SV=1 | 110 | 263 | 9.0E-12 |
sp|Q16AK0|RNH_ROSDO | Ribonuclease H OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rnhA PE=3 SV=1 | 114 | 264 | 1.0E-11 |
sp|Q5QZL3|RNH_IDILO | Ribonuclease H OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rnhA PE=3 SV=1 | 109 | 273 | 1.0E-11 |
sp|Q65S82|RNH_MANSM | Ribonuclease H OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rnhA PE=3 SV=1 | 110 | 272 | 1.0E-11 |
sp|Q8GF77|RNH_PHOLU | Ribonuclease H OS=Photorhabdus luminescens GN=rnhA PE=3 SV=1 | 109 | 271 | 1.0E-11 |
sp|Q7MII6|RNH_VIBVY | Ribonuclease H OS=Vibrio vulnificus (strain YJ016) GN=rnhA PE=3 SV=1 | 109 | 273 | 1.0E-11 |
sp|Q8DBD5|RNH_VIBVU | Ribonuclease HI OS=Vibrio vulnificus (strain CMCP6) GN=rnhA PE=3 SV=1 | 109 | 273 | 1.0E-11 |
sp|Q3J7D4|RNH_NITOC | Ribonuclease H OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rnhA PE=3 SV=1 | 112 | 265 | 2.0E-11 |
sp|Q73I74|RNH_WOLPM | Ribonuclease H OS=Wolbachia pipientis wMel GN=rnhA PE=3 SV=1 | 110 | 265 | 2.0E-11 |
sp|Q7VM15|RNH_HAEDU | Ribonuclease HI OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rnhA PE=3 SV=1 | 112 | 260 | 2.0E-11 |
sp|Q5E3G5|RNH_VIBF1 | Ribonuclease H OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rnhA PE=3 SV=1 | 110 | 273 | 2.0E-11 |
sp|P57813|RNH_PASMU | Ribonuclease HI OS=Pasteurella multocida (strain Pm70) GN=rnhA PE=3 SV=1 | 109 | 271 | 2.0E-11 |
sp|A7HQX4|RNH_PARL1 | Ribonuclease H OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rnhA PE=3 SV=1 | 112 | 264 | 2.0E-11 |
sp|C5BEV5|RNH_EDWI9 | Ribonuclease H OS=Edwardsiella ictaluri (strain 93-146) GN=rnhA PE=3 SV=1 | 110 | 273 | 3.0E-11 |
sp|A8AKR0|RNH_CITK8 | Ribonuclease H OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rnhA PE=3 SV=1 | 110 | 265 | 3.0E-11 |
sp|A7GAG3|RNH_CLOBL | Ribonuclease H OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rnhA PE=3 SV=1 | 110 | 263 | 3.0E-11 |
sp|A5HYU6|RNH_CLOBH | Ribonuclease H OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rnhA PE=3 SV=1 | 110 | 263 | 3.0E-11 |
sp|A7FR34|RNH_CLOB1 | Ribonuclease H OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rnhA PE=3 SV=1 | 110 | 263 | 3.0E-11 |
sp|A1AT66|RNH_PELPD | Ribonuclease H OS=Pelobacter propionicus (strain DSM 2379) GN=rnhA PE=3 SV=1 | 112 | 265 | 4.0E-11 |
sp|C3LPN8|RNH_VIBCM | Ribonuclease H OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rnhA PE=3 SV=1 | 109 | 272 | 4.0E-11 |
sp|Q9KPX8|RNH_VIBCH | Ribonuclease HI OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnhA PE=3 SV=1 | 109 | 272 | 4.0E-11 |
sp|A5F633|RNH_VIBC3 | Ribonuclease H OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rnhA PE=3 SV=1 | 109 | 272 | 4.0E-11 |
sp|Q88FF5|RNH_PSEPK | Ribonuclease HI OS=Pseudomonas putida (strain KT2440) GN=rnhA PE=3 SV=1 | 109 | 263 | 4.0E-11 |
sp|B0KN00|RNH_PSEPG | Ribonuclease H OS=Pseudomonas putida (strain GB-1) GN=rnhA PE=3 SV=1 | 109 | 263 | 4.0E-11 |
sp|A5W169|RNH_PSEP1 | Ribonuclease H OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rnhA PE=3 SV=1 | 109 | 263 | 4.0E-11 |
sp|Q5PBQ8|RNH_ANAMM | Ribonuclease H OS=Anaplasma marginale (strain St. Maries) GN=rnhA PE=3 SV=2 | 110 | 263 | 4.0E-11 |
sp|A4VLR0|RNH_PSEU5 | Ribonuclease H OS=Pseudomonas stutzeri (strain A1501) GN=rnhA PE=3 SV=1 | 112 | 263 | 5.0E-11 |
sp|A6V705|RNH_PSEA7 | Ribonuclease H OS=Pseudomonas aeruginosa (strain PA7) GN=rnhA PE=3 SV=1 | 109 | 265 | 6.0E-11 |
sp|Q5NYP6|RNH_AROAE | Ribonuclease H OS=Aromatoleum aromaticum (strain EbN1) GN=rnhA PE=3 SV=1 | 112 | 263 | 6.0E-11 |
sp|B8HPS9|RNH_CYAP4 | Ribonuclease H OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rnhA PE=3 SV=1 | 114 | 230 | 6.0E-11 |
sp|Q12MM4|RNH_SHEDO | Ribonuclease H OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rnhA PE=3 SV=1 | 110 | 263 | 6.0E-11 |
sp|Q2NVF9|RNH_SODGM | Ribonuclease H OS=Sodalis glossinidius (strain morsitans) GN=rnhA PE=3 SV=1 | 110 | 263 | 6.0E-11 |
sp|Q8UHA7|RNH_AGRFC | Ribonuclease H OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rnhA PE=3 SV=1 | 110 | 263 | 6.0E-11 |
sp|A6WWG8|RNH_OCHA4 | Ribonuclease H OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rnhA PE=3 SV=1 | 110 | 263 | 7.0E-11 |
sp|A7ZWF6|RNH_ECOHS | Ribonuclease H OS=Escherichia coli O9:H4 (strain HS) GN=rnhA PE=3 SV=1 | 110 | 265 | 7.0E-11 |
sp|B7LHC0|RNH_ECO55 | Ribonuclease H OS=Escherichia coli (strain 55989 / EAEC) GN=rnhA PE=3 SV=1 | 110 | 265 | 7.0E-11 |
sp|Q0TLC3|RNH_ECOL5 | Ribonuclease H OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rnhA PE=3 SV=1 | 110 | 265 | 7.0E-11 |
sp|B7UJB0|RNH_ECO27 | Ribonuclease H OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rnhA PE=3 SV=1 | 110 | 265 | 7.0E-11 |
sp|Q3Z5E9|RNH_SHISS | Ribonuclease H OS=Shigella sonnei (strain Ss046) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|P0A7Y7|RNH_SHIFL | Ribonuclease HI OS=Shigella flexneri GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|Q32JP9|RNH_SHIDS | Ribonuclease H OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|Q325T2|RNH_SHIBS | Ribonuclease H OS=Shigella boydii serotype 4 (strain Sb227) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|B2U352|RNH_SHIB3 | Ribonuclease H OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|B7LW89|RNH_ESCF3 | Ribonuclease H OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|B1LHM3|RNH_ECOSM | Ribonuclease H OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|B6HZS7|RNH_ECOSE | Ribonuclease H OS=Escherichia coli (strain SE11) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|B7N876|RNH_ECOLU | Ribonuclease H OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|P0A7Y4|RNH_ECOLI | Ribonuclease HI OS=Escherichia coli (strain K12) GN=rnhA PE=1 SV=1 | 110 | 265 | 8.0E-11 |
sp|B1IPU4|RNH_ECOLC | Ribonuclease H OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|P0A7Y5|RNH_ECOL6 | Ribonuclease HI OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|B1XD78|RNH_ECODH | Ribonuclease H OS=Escherichia coli (strain K12 / DH10B) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|C4ZRV1|RNH_ECOBW | Ribonuclease H OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|B7M213|RNH_ECO8A | Ribonuclease H OS=Escherichia coli O8 (strain IAI1) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|B7MQ23|RNH_ECO81 | Ribonuclease H OS=Escherichia coli O81 (strain ED1a) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|B7NKW4|RNH_ECO7I | Ribonuclease H OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|B5Z0I8|RNH_ECO5E | Ribonuclease H OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|P0A7Y6|RNH_ECO57 | Ribonuclease HI OS=Escherichia coli O157:H7 GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|B7MBJ0|RNH_ECO45 | Ribonuclease H OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|A7ZHV1|RNH_ECO24 | Ribonuclease H OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rnhA PE=3 SV=1 | 110 | 265 | 8.0E-11 |
sp|Q9I2S9|RNH_PSEAE | Ribonuclease HI OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rnhA PE=3 SV=1 | 109 | 265 | 8.0E-11 |
sp|Q02KV8|RNH_PSEAB | Ribonuclease H OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rnhA PE=3 SV=1 | 109 | 265 | 8.0E-11 |
sp|B7VB62|RNH_PSEA8 | Ribonuclease H OS=Pseudomonas aeruginosa (strain LESB58) GN=rnhA PE=3 SV=1 | 109 | 265 | 8.0E-11 |
sp|Q4KBI1|RNH_PSEF5 | Ribonuclease H OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rnhA PE=3 SV=1 | 109 | 263 | 9.0E-11 |
sp|B4EUG3|RNH_PROMH | Ribonuclease H OS=Proteus mirabilis (strain HI4320) GN=rnhA PE=3 SV=1 | 110 | 273 | 9.0E-11 |
sp|A0KXS6|RNH_SHESA | Ribonuclease H OS=Shewanella sp. (strain ANA-3) GN=rnhA PE=3 SV=1 | 112 | 273 | 9.0E-11 |
sp|A6U6V5|RNH_SINMW | Ribonuclease H OS=Sinorhizobium medicae (strain WSM419) GN=rnhA PE=3 SV=1 | 110 | 263 | 1.0E-10 |
sp|C6DC65|RNH_PECCP | Ribonuclease H OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rnhA PE=3 SV=1 | 110 | 264 | 1.0E-10 |
sp|A3PMR3|RNH_RHOS1 | Ribonuclease H OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rnhA PE=3 SV=1 | 114 | 264 | 1.0E-10 |
sp|A3QET0|RNH_SHELP | Ribonuclease H OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rnhA PE=3 SV=1 | 110 | 271 | 1.0E-10 |
sp|A4WNV1|RNH_RHOS5 | Ribonuclease H OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rnhA PE=3 SV=1 | 114 | 264 | 1.0E-10 |
sp|Q9UST8|RNH1_SCHPO | Ribonuclease H OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnh1 PE=1 SV=1 | 114 | 265 | 2.0E-10 |
sp|Q0VQ76|RNH_ALCBS | Ribonuclease H OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rnhA PE=3 SV=1 | 110 | 263 | 2.0E-10 |
sp|Q3BWP3|RNH_XANC5 | Ribonuclease H OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rnhA PE=3 SV=1 | 112 | 270 | 2.0E-10 |
sp|Q5WWW5|RNH_LEGPL | Ribonuclease H OS=Legionella pneumophila (strain Lens) GN=rnhA PE=3 SV=1 | 112 | 231 | 2.0E-10 |
sp|A9L0F2|RNH_SHEB9 | Ribonuclease H OS=Shewanella baltica (strain OS195) GN=rnhA PE=3 SV=1 | 112 | 271 | 2.0E-10 |
sp|A6WMW8|RNH_SHEB8 | Ribonuclease H OS=Shewanella baltica (strain OS185) GN=rnhA PE=3 SV=1 | 112 | 271 | 2.0E-10 |
sp|A3D440|RNH_SHEB5 | Ribonuclease H OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rnhA PE=3 SV=1 | 112 | 271 | 2.0E-10 |
sp|B8E599|RNH_SHEB2 | Ribonuclease H OS=Shewanella baltica (strain OS223) GN=rnhA PE=3 SV=1 | 112 | 271 | 2.0E-10 |
sp|A8GA77|RNH_SERP5 | Ribonuclease H OS=Serratia proteamaculans (strain 568) GN=rnhA PE=3 SV=1 | 110 | 272 | 2.0E-10 |
sp|B1JBN1|RNH_PSEPW | Ribonuclease H OS=Pseudomonas putida (strain W619) GN=rnhA PE=3 SV=1 | 109 | 263 | 2.0E-10 |
sp|A9IQR5|RNH_BART1 | Ribonuclease H OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rnhA PE=3 SV=1 | 112 | 265 | 2.0E-10 |
sp|Q9PBI6|RNH_XYLFA | Ribonuclease HI OS=Xylella fastidiosa (strain 9a5c) GN=rnhA PE=3 SV=2 | 110 | 269 | 2.0E-10 |
sp|A0KIK4|RNH_AERHH | Ribonuclease H OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rnhA PE=3 SV=1 | 110 | 271 | 2.0E-10 |
sp|A8FUS8|RNH_SHESH | Ribonuclease H OS=Shewanella sediminis (strain HAW-EB3) GN=rnhA PE=3 SV=1 | 110 | 271 | 2.0E-10 |
sp|Q87C76|RNH_XYLFT | Ribonuclease HI OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rnhA PE=3 SV=1 | 112 | 269 | 2.0E-10 |
sp|Q47FN9|RNH_DECAR | Ribonuclease H OS=Dechloromonas aromatica (strain RCB) GN=rnhA PE=3 SV=1 | 112 | 265 | 3.0E-10 |
sp|Q1LL89|RNH_CUPMC | Ribonuclease H OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rnhA PE=3 SV=1 | 110 | 265 | 3.0E-10 |
sp|Q0HI86|RNH_SHESM | Ribonuclease H OS=Shewanella sp. (strain MR-4) GN=rnhA PE=3 SV=1 | 112 | 273 | 3.0E-10 |
sp|Q48KX6|RNH_PSE14 | Ribonuclease H OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rnhA PE=3 SV=1 | 109 | 263 | 3.0E-10 |
sp|Q0HUI2|RNH_SHESR | Ribonuclease H OS=Shewanella sp. (strain MR-7) GN=rnhA PE=3 SV=1 | 112 | 273 | 3.0E-10 |
sp|Q8EE30|RNH_SHEON | Ribonuclease HI OS=Shewanella oneidensis (strain MR-1) GN=rnhA PE=1 SV=1 | 112 | 273 | 3.0E-10 |
sp|B1KHK0|RNH_SHEWM | Ribonuclease H OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rnhA PE=3 SV=1 | 110 | 272 | 4.0E-10 |
sp|Q89UU3|RNH_BRADU | Ribonuclease H OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rnhA PE=3 SV=1 | 112 | 263 | 4.0E-10 |
sp|Q11KC5|RNH_CHESB | Ribonuclease H OS=Chelativorans sp. (strain BNC1) GN=rnhA PE=3 SV=1 | 110 | 264 | 4.0E-10 |
sp|B2S2V0|RNH_TREPS | Ribonuclease H OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rnhA PE=3 SV=1 | 112 | 263 | 4.0E-10 |
sp|O83372|RNH_TREPA | Ribonuclease H OS=Treponema pallidum (strain Nichols) GN=rnhA PE=3 SV=1 | 112 | 263 | 4.0E-10 |
sp|B0T025|RNH_CAUSK | Ribonuclease H OS=Caulobacter sp. (strain K31) GN=rnhA PE=3 SV=1 | 112 | 260 | 4.0E-10 |
sp|Q5UPY1|RNH_MIMIV | Probable ribonuclease H OS=Acanthamoeba polyphaga mimivirus GN=RNH1 PE=3 SV=1 | 122 | 263 | 4.0E-10 |
sp|A4T6Y5|RNH_MYCGI | Ribonuclease H OS=Mycobacterium gilvum (strain PYR-GCK) GN=rnhA PE=3 SV=1 | 112 | 270 | 5.0E-10 |
sp|A1WXD7|RNH_HALHL | Ribonuclease H OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rnhA PE=3 SV=1 | 112 | 263 | 5.0E-10 |
sp|A1RK75|RNH_SHESW | Ribonuclease H OS=Shewanella sp. (strain W3-18-1) GN=rnhA PE=3 SV=1 | 112 | 273 | 5.0E-10 |
sp|A4Y6C1|RNH_SHEPC | Ribonuclease H OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rnhA PE=3 SV=1 | 112 | 273 | 5.0E-10 |
sp|B4S5K2|RNH_PROA2 | Ribonuclease H OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rnhA PE=3 SV=1 | 110 | 265 | 5.0E-10 |
sp|B2VHJ5|RNH_ERWT9 | Ribonuclease H OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rnhA PE=3 SV=1 | 110 | 265 | 5.0E-10 |
sp|A4XU11|RNH_PSEMY | Ribonuclease H OS=Pseudomonas mendocina (strain ymp) GN=rnhA PE=3 SV=1 | 112 | 263 | 6.0E-10 |
sp|Q5H426|RNH_XANOR | Ribonuclease H OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rnhA PE=3 SV=1 | 110 | 270 | 6.0E-10 |
sp|Q2P6Y2|RNH_XANOM | Ribonuclease H OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rnhA PE=3 SV=1 | 110 | 270 | 6.0E-10 |
sp|B7VIP1|RNH_VIBTL | Ribonuclease H OS=Vibrio tasmaniensis (strain LGP32) GN=rnhA PE=3 SV=1 | 109 | 273 | 7.0E-10 |
sp|Q7NYL8|RNH_CHRVO | Ribonuclease H OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rnhA PE=3 SV=1 | 112 | 263 | 8.0E-10 |
sp|B3QM41|RNH_CHLP8 | Ribonuclease H OS=Chlorobaculum parvum (strain NCIB 8327) GN=rnhA PE=3 SV=1 | 112 | 267 | 8.0E-10 |
sp|A1AW38|RNH_RUTMC | Ribonuclease H OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rnhA PE=3 SV=1 | 112 | 263 | 8.0E-10 |
sp|Q2LWY9|RNH_SYNAS | Ribonuclease H OS=Syntrophus aciditrophicus (strain SB) GN=rnhA PE=3 SV=1 | 105 | 271 | 8.0E-10 |
sp|Q1QW64|RNH_CHRSD | Ribonuclease H OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rnhA PE=3 SV=1 | 112 | 266 | 1.0E-09 |
sp|Q1I7T4|RNH_PSEE4 | Ribonuclease H OS=Pseudomonas entomophila (strain L48) GN=rnhA PE=3 SV=1 | 109 | 263 | 1.0E-09 |
sp|A1BE10|RNH_CHLPD | Ribonuclease H OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rnhA PE=3 SV=1 | 110 | 265 | 1.0E-09 |
sp|Q2ND39|RNH_ERYLH | Ribonuclease H OS=Erythrobacter litoralis (strain HTCC2594) GN=rnhA PE=3 SV=1 | 110 | 263 | 1.0E-09 |
sp|Q87YT0|RNH_PSESM | Ribonuclease HI OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rnhA PE=3 SV=1 | 109 | 263 | 1.0E-09 |
sp|Q5ZVQ7|RNH_LEGPH | Ribonuclease H OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rnhA PE=3 SV=1 | 112 | 231 | 1.0E-09 |
sp|A5IBM5|RNH_LEGPC | Ribonuclease H OS=Legionella pneumophila (strain Corby) GN=rnhA PE=3 SV=1 | 112 | 231 | 1.0E-09 |
sp|Q5X5I2|RNH_LEGPA | Ribonuclease H OS=Legionella pneumophila (strain Paris) GN=rnhA PE=3 SV=1 | 112 | 231 | 1.0E-09 |
sp|Q83EK3|RNH_COXBU | Ribonuclease H OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rnhA PE=3 SV=1 | 107 | 263 | 1.0E-09 |
sp|A9NB52|RNH_COXBR | Ribonuclease H OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rnhA PE=3 SV=1 | 107 | 263 | 1.0E-09 |
sp|B6J5V1|RNH_COXB1 | Ribonuclease H OS=Coxiella burnetii (strain CbuK_Q154) GN=rnhA PE=3 SV=1 | 105 | 263 | 1.0E-09 |
sp|A9KGQ0|RNH_COXBN | Ribonuclease H OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rnhA PE=3 SV=1 | 105 | 263 | 1.0E-09 |
sp|B6J1Y7|RNH_COXB2 | Ribonuclease H OS=Coxiella burnetii (strain CbuG_Q212) GN=rnhA PE=3 SV=1 | 105 | 263 | 1.0E-09 |
sp|Q4ZVL1|RNH_PSEU2 | Ribonuclease H OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rnhA PE=3 SV=1 | 109 | 263 | 1.0E-09 |
sp|A1URX4|RNH_BARBK | Ribonuclease H OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rnhA PE=3 SV=1 | 112 | 265 | 2.0E-09 |
sp|P66674|RNH_BRUSU | Ribonuclease HI OS=Brucella suis biovar 1 (strain 1330) GN=rnhA PE=3 SV=1 | 110 | 263 | 2.0E-09 |
sp|B0CKG2|RNH_BRUSI | Ribonuclease H OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rnhA PE=3 SV=1 | 110 | 263 | 2.0E-09 |
sp|A5VP47|RNH_BRUO2 | Ribonuclease H OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rnhA PE=3 SV=1 | 110 | 263 | 2.0E-09 |
sp|P66673|RNH_BRUME | Ribonuclease HI OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rnhA PE=3 SV=1 | 110 | 263 | 2.0E-09 |
sp|Q57EP4|RNH_BRUAB | Ribonuclease H OS=Brucella abortus biovar 1 (strain 9-941) GN=rnhA PE=3 SV=1 | 110 | 263 | 2.0E-09 |
sp|Q2YMI3|RNH_BRUA2 | Ribonuclease H OS=Brucella abortus (strain 2308) GN=rnhA PE=3 SV=1 | 110 | 263 | 2.0E-09 |
sp|B1JR46|RNH_YERPY | Ribonuclease H OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rnhA PE=3 SV=1 | 109 | 263 | 2.0E-09 |
sp|Q667M7|RNH_YERPS | Ribonuclease H OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rnhA PE=3 SV=1 | 109 | 263 | 2.0E-09 |
sp|A4TL54|RNH_YERPP | Ribonuclease H OS=Yersinia pestis (strain Pestoides F) GN=rnhA PE=3 SV=1 | 109 | 263 | 2.0E-09 |
sp|Q1CFI6|RNH_YERPN | Ribonuclease H OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rnhA PE=3 SV=1 | 109 | 263 | 2.0E-09 |
sp|A9R0G0|RNH_YERPG | Ribonuclease H OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rnhA PE=3 SV=1 | 109 | 263 | 2.0E-09 |
sp|Q8ZH30|RNH_YERPE | Ribonuclease HI OS=Yersinia pestis GN=rnhA PE=3 SV=1 | 109 | 263 | 2.0E-09 |
sp|B2KAC9|RNH_YERPB | Ribonuclease H OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rnhA PE=3 SV=1 | 109 | 263 | 2.0E-09 |
sp|Q1CAJ5|RNH_YERPA | Ribonuclease H OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rnhA PE=3 SV=1 | 109 | 263 | 2.0E-09 |
sp|A7FFK7|RNH_YERP3 | Ribonuclease H OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rnhA PE=3 SV=1 | 109 | 263 | 2.0E-09 |
sp|Q8PBX8|RNH_XANCP | Ribonuclease H OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rnhA PE=3 SV=1 | 112 | 261 | 2.0E-09 |
sp|Q4URM3|RNH_XANC8 | Ribonuclease H OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rnhA PE=3 SV=1 | 112 | 261 | 2.0E-09 |
sp|C4LC60|RNH_TOLAT | Ribonuclease H OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rnhA PE=3 SV=1 | 110 | 263 | 2.0E-09 |
sp|A1VMW5|RNH_POLNA | Ribonuclease H OS=Polaromonas naphthalenivorans (strain CJ2) GN=rnhA PE=3 SV=1 | 108 | 263 | 2.0E-09 |
sp|Q1LT02|RNH_BAUCH | Ribonuclease H OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rnhA PE=3 SV=1 | 112 | 272 | 2.0E-09 |
sp|A4SXM6|RNH_POLSQ | Ribonuclease H OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rnhA PE=3 SV=1 | 111 | 265 | 2.0E-09 |
sp|Q46Z81|RNH_CUPPJ | Ribonuclease H OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rnhA PE=3 SV=1 | 110 | 265 | 2.0E-09 |
sp|Q3SIB2|RNH_THIDA | Ribonuclease H OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rnhA PE=3 SV=1 | 112 | 263 | 2.0E-09 |
sp|A3DD79|RNH_CLOTH | Ribonuclease H OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rnhA PE=3 SV=1 | 110 | 263 | 2.0E-09 |
sp|A1W6Q8|RNH_ACISJ | Ribonuclease H OS=Acidovorax sp. (strain JS42) GN=rnhA PE=3 SV=1 | 111 | 263 | 2.0E-09 |
sp|B3EH35|RNH_CHLL2 | Ribonuclease H OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rnhA PE=3 SV=1 | 105 | 265 | 3.0E-09 |
sp|Q2W9A9|RNH_MAGSA | Ribonuclease H OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rnhA PE=3 SV=1 | 108 | 265 | 3.0E-09 |
sp|Q6D1V7|RNH_PECAS | Ribonuclease H OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rnhA PE=3 SV=1 | 110 | 264 | 3.0E-09 |
sp|B7JVG1|RNH_CYAP8 | Ribonuclease H OS=Cyanothece sp. (strain PCC 8801) GN=rnhA PE=3 SV=1 | 110 | 272 | 3.0E-09 |
sp|Q15TA7|RNH_PSEA6 | Ribonuclease H OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rnhA PE=3 SV=1 | 110 | 273 | 4.0E-09 |
sp|Q081L4|RNH_SHEFN | Ribonuclease H OS=Shewanella frigidimarina (strain NCIMB 400) GN=rnhA PE=3 SV=1 | 110 | 271 | 4.0E-09 |
sp|B3Q6U1|RNH_RHOPT | Ribonuclease H OS=Rhodopseudomonas palustris (strain TIE-1) GN=rnhA PE=3 SV=1 | 112 | 265 | 4.0E-09 |
sp|Q6N1Y3|RNH_RHOPA | Ribonuclease H OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rnhA PE=3 SV=1 | 112 | 265 | 4.0E-09 |
sp|A4SFZ9|RNH_CHLPM | Ribonuclease H OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rnhA PE=3 SV=1 | 110 | 263 | 4.0E-09 |
sp|Q3KE77|RNH_PSEPF | Ribonuclease H OS=Pseudomonas fluorescens (strain Pf0-1) GN=rnhA PE=3 SV=1 | 112 | 263 | 4.0E-09 |
sp|Q28V43|RNH_JANSC | Ribonuclease H OS=Jannaschia sp. (strain CCS1) GN=rnhA PE=3 SV=1 | 112 | 264 | 5.0E-09 |
sp|A2C030|RNH_PROM1 | Ribonuclease H OS=Prochlorococcus marinus (strain NATL1A) GN=rnhA PE=3 SV=1 | 106 | 228 | 6.0E-09 |
sp|A5CX29|RNH_VESOH | Ribonuclease H OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rnhA PE=3 SV=1 | 110 | 263 | 6.0E-09 |
sp|B3EMT1|RNH_CHLPB | Ribonuclease H OS=Chlorobium phaeobacteroides (strain BS1) GN=rnhA PE=3 SV=1 | 110 | 265 | 6.0E-09 |
sp|Q46HH3|RNH_PROMT | Ribonuclease H OS=Prochlorococcus marinus (strain NATL2A) GN=rnhA PE=3 SV=1 | 106 | 259 | 6.0E-09 |
sp|A1JKB1|RNH_YERE8 | Ribonuclease H OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rnhA PE=3 SV=1 | 109 | 263 | 7.0E-09 |
sp|Q131J2|RNH_RHOPS | Ribonuclease H OS=Rhodopseudomonas palustris (strain BisB5) GN=rnhA PE=3 SV=1 | 112 | 263 | 7.0E-09 |
sp|Q1GDG1|RNH_RUEST | Ribonuclease H OS=Ruegeria sp. (strain TM1040) GN=rnhA PE=3 SV=1 | 114 | 273 | 8.0E-09 |
sp|Q5LNJ2|RNH_RUEPO | Ribonuclease H OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rnhA PE=3 SV=1 | 114 | 263 | 8.0E-09 |
sp|Q8PNH8|RNH_XANAC | Ribonuclease H OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rnhA PE=3 SV=1 | 112 | 261 | 9.0E-09 |
sp|Q2GHJ9|RNH_EHRCR | Ribonuclease H OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rnhA PE=3 SV=1 | 105 | 264 | 9.0E-09 |
sp|A6SXA4|RNH_JANMA | Ribonuclease H OS=Janthinobacterium sp. (strain Marseille) GN=rnhA PE=3 SV=1 | 112 | 228 | 1.0E-08 |
sp|Q8XZ91|RNH_RALSO | Ribonuclease H OS=Ralstonia solanacearum (strain GMI1000) GN=rnhA PE=3 SV=1 | 110 | 263 | 1.0E-08 |
sp|A1TQI7|RNH_ACIAC | Ribonuclease H OS=Acidovorax citrulli (strain AAC00-1) GN=rnhA PE=3 SV=1 | 111 | 263 | 2.0E-08 |
sp|Q7WCJ8|RNH_BORBR | Ribonuclease H OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rnhA PE=3 SV=1 | 109 | 263 | 2.0E-08 |
sp|Q07705|RNH_MYCSM | Ribonuclease H OS=Mycobacterium smegmatis GN=rnhA PE=3 SV=2 | 112 | 273 | 2.0E-08 |
sp|A0R3Q8|RNH_MYCS2 | Ribonuclease H OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rnhA PE=3 SV=1 | 112 | 273 | 2.0E-08 |
sp|Q2J0F8|RNH_RHOP2 | Ribonuclease H OS=Rhodopseudomonas palustris (strain HaA2) GN=rnhA PE=3 SV=1 | 112 | 265 | 2.0E-08 |
sp|B4R8T3|RNH_PHEZH | Ribonuclease H OS=Phenylobacterium zucineum (strain HLK1) GN=rnhA PE=3 SV=1 | 112 | 265 | 2.0E-08 |
sp|Q5FG88|RNH_EHRRG | Ribonuclease H OS=Ehrlichia ruminantium (strain Gardel) GN=rnhA PE=3 SV=2 | 105 | 264 | 3.0E-08 |
sp|Q6G0C8|RNH_BARQU | Ribonuclease H OS=Bartonella quintana (strain Toulouse) GN=rnhA PE=3 SV=1 | 112 | 265 | 3.0E-08 |
sp|Q0AV47|RNH_SYNWW | Ribonuclease H OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rnhA PE=3 SV=1 | 110 | 263 | 3.0E-08 |
sp|Q60AW8|RNH_METCA | Ribonuclease H OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rnhA PE=3 SV=1 | 112 | 271 | 3.0E-08 |
sp|Q0RJ31|RNH_FRAAA | Ribonuclease H OS=Frankia alni (strain ACN14a) GN=rnhA PE=3 SV=1 | 114 | 273 | 3.0E-08 |
sp|A4G7G3|RNH_HERAR | Ribonuclease H OS=Herminiimonas arsenicoxydans GN=rnhA PE=3 SV=1 | 110 | 228 | 3.0E-08 |
sp|Q0C3M1|RNH_HYPNA | Ribonuclease H OS=Hyphomonas neptunium (strain ATCC 15444) GN=rnhA PE=3 SV=1 | 112 | 263 | 3.0E-08 |
sp|Q2Y8K1|RNH_NITMU | Ribonuclease H OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rnhA PE=3 SV=1 | 107 | 263 | 3.0E-08 |
sp|Q0K8W6|RNH_CUPNH | Ribonuclease H OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rnhA PE=3 SV=1 | 110 | 263 | 4.0E-08 |
sp|Q7VRX8|RNH_BORPE | Ribonuclease H OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rnhA PE=3 SV=1 | 109 | 263 | 4.0E-08 |
sp|Q2RPU6|RNH_RHORT | Ribonuclease H OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rnhA PE=3 SV=1 | 112 | 265 | 4.0E-08 |
sp|Q6G4C3|RNH_BARHE | Ribonuclease H OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rnhA PE=3 SV=1 | 112 | 265 | 4.0E-08 |
sp|Q2RKU0|RNH_MOOTA | Ribonuclease H OS=Moorella thermoacetica (strain ATCC 39073) GN=rnhA PE=3 SV=1 | 110 | 257 | 5.0E-08 |
sp|Q0A753|RNH_ALKEH | Ribonuclease H OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rnhA PE=3 SV=1 | 114 | 263 | 5.0E-08 |
sp|Q12B88|RNH_POLSJ | Ribonuclease H OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rnhA PE=3 SV=1 | 112 | 263 | 5.0E-08 |
sp|Q2KV56|RNH_BORA1 | Ribonuclease H OS=Bordetella avium (strain 197N) GN=rnhA PE=3 SV=1 | 112 | 264 | 5.0E-08 |
sp|B5EMD8|RNH_ACIF5 | Ribonuclease H OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rnhA PE=3 SV=1 | 112 | 227 | 7.0E-08 |
sp|B7J4E2|RNH_ACIF2 | Ribonuclease H OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rnhA PE=3 SV=1 | 112 | 227 | 7.0E-08 |
sp|A1B840|RNH_PARDP | Ribonuclease H OS=Paracoccus denitrificans (strain Pd 1222) GN=rnhA PE=3 SV=1 | 114 | 264 | 8.0E-08 |
sp|Q7VDY9|RNH_PROMA | Ribonuclease H OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rnhA PE=3 SV=1 | 105 | 259 | 8.0E-08 |
sp|A1U0U9|RNH_MARHV | Ribonuclease H OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rnhA PE=3 SV=1 | 112 | 263 | 9.0E-08 |
sp|A7HB50|RNH_ANADF | Ribonuclease H OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rnhA PE=3 SV=1 | 115 | 271 | 9.0E-08 |
sp|A8EXT7|RNH_RICCK | Ribonuclease H OS=Rickettsia canadensis (strain McKiel) GN=rnhA PE=3 SV=1 | 112 | 227 | 1.0E-07 |
sp|Q9A341|RNH_CAUCR | Ribonuclease HI OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rnhA PE=3 SV=1 | 109 | 263 | 1.0E-07 |
sp|B8H4W7|RNH_CAUCN | Ribonuclease H OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rnhA PE=3 SV=1 | 109 | 263 | 1.0E-07 |
sp|Q2GDA1|RNH_NEOSM | Ribonuclease H OS=Neorickettsia sennetsu (strain Miyayama) GN=rnhA PE=3 SV=1 | 114 | 227 | 1.0E-07 |
sp|A4FMU3|RNH_SACEN | Ribonuclease H OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rnhA PE=3 SV=1 | 112 | 259 | 1.0E-07 |
sp|Q21YF6|RNH_RHOFT | Ribonuclease H OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rnhA PE=3 SV=1 | 112 | 231 | 1.0E-07 |
sp|A8F2L0|RNH_RICM5 | Ribonuclease H OS=Rickettsia massiliae (strain Mtu5) GN=rnhA PE=3 SV=2 | 112 | 227 | 1.0E-07 |
sp|Q39X47|RNH_GEOMG | Ribonuclease H OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rnhA PE=3 SV=1 | 155 | 263 | 1.0E-07 |
sp|Q4UN27|RNH_RICFE | Ribonuclease H OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rnhA PE=3 SV=1 | 112 | 227 | 1.0E-07 |
sp|Q3B2H0|RNH_CHLL7 | Ribonuclease H OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rnhA PE=3 SV=2 | 110 | 263 | 2.0E-07 |
sp|Q01RW8|RNH_SOLUE | Ribonuclease H OS=Solibacter usitatus (strain Ellin6076) GN=rnhA PE=3 SV=1 | 110 | 269 | 2.0E-07 |
sp|Q9ZCK3|RNH_RICPR | Ribonuclease HI OS=Rickettsia prowazekii (strain Madrid E) GN=rnhA PE=3 SV=1 | 112 | 227 | 2.0E-07 |
sp|Q1H190|RNH_METFK | Ribonuclease H OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rnhA PE=3 SV=1 | 109 | 263 | 2.0E-07 |
sp|A1WFG9|RNH_VEREI | Ribonuclease H OS=Verminephrobacter eiseniae (strain EF01-2) GN=rnhA PE=3 SV=1 | 111 | 263 | 2.0E-07 |
sp|Q92GL5|RNH_RICCN | Ribonuclease HI OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rnhA PE=3 SV=2 | 112 | 227 | 2.0E-07 |
sp|A8GPT6|RNH_RICAH | Ribonuclease H OS=Rickettsia akari (strain Hartford) GN=rnhA PE=3 SV=1 | 112 | 227 | 2.0E-07 |
sp|A8LLC1|RNH_DINSH | Ribonuclease H OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rnhA PE=3 SV=1 | 114 | 264 | 3.0E-07 |
sp|Q07762|RNH1_CRIFA | Ribonuclease H OS=Crithidia fasciculata GN=RNH1 PE=3 SV=1 | 114 | 239 | 3.0E-07 |
sp|Q3YR62|RNH_EHRCJ | Ribonuclease H OS=Ehrlichia canis (strain Jake) GN=rnhA PE=3 SV=1 | 105 | 230 | 3.0E-07 |
sp|A4J7B3|RNH_DESRM | Ribonuclease H OS=Desulfotomaculum reducens (strain MI-1) GN=rnhA PE=3 SV=1 | 110 | 271 | 3.0E-07 |
sp|A1SS86|RNH_PSYIN | Ribonuclease H OS=Psychromonas ingrahamii (strain 37) GN=rnhA PE=3 SV=2 | 110 | 272 | 4.0E-07 |
sp|Q04740|RNH1_YEAST | Ribonuclease H OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH1 PE=1 SV=2 | 109 | 208 | 4.0E-07 |
sp|Q8RA67|RNH_CALS4 | Ribonuclease H OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rnhA PE=3 SV=1 | 105 | 263 | 5.0E-07 |
sp|Q1RJL7|RNH_RICBR | Ribonuclease H OS=Rickettsia bellii (strain RML369-C) GN=rnhA PE=3 SV=1 | 112 | 229 | 6.0E-07 |
sp|P29253|RNH_THET8 | Ribonuclease H OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rnhA PE=1 SV=2 | 110 | 269 | 8.0E-07 |
sp|Q2SJ45|RNH_HAHCH | Ribonuclease H OS=Hahella chejuensis (strain KCTC 2396) GN=rnhA PE=3 SV=1 | 112 | 265 | 8.0E-07 |
sp|B4UMK8|RNH_ANASK | Ribonuclease H OS=Anaeromyxobacter sp. (strain K) GN=rnhA PE=3 SV=1 | 147 | 263 | 9.0E-07 |
sp|Q2IJL8|RNH_ANADE | Ribonuclease H OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rnhA PE=3 SV=1 | 150 | 263 | 1.0E-06 |
sp|B8J731|RNH_ANAD2 | Ribonuclease H OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rnhA PE=3 SV=1 | 147 | 263 | 1.0E-06 |
sp|Q7UF86|RNH_RHOBA | Ribonuclease H OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rnhA PE=3 SV=1 | 112 | 262 | 1.0E-06 |
sp|Q83GM3|RNH_TROWT | Ribonuclease H OS=Tropheryma whipplei (strain Twist) GN=rnhA PE=3 SV=1 | 165 | 263 | 2.0E-06 |
sp|Q83HK9|RNH_TROW8 | Ribonuclease H OS=Tropheryma whipplei (strain TW08/27) GN=rnhA PE=3 SV=1 | 165 | 263 | 2.0E-06 |
sp|A4XKQ3|RNH_CALS8 | Ribonuclease H OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rnhA PE=3 SV=1 | 110 | 265 | 2.0E-06 |
sp|Q68W20|RNH_RICTY | Ribonuclease H OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rnhA PE=3 SV=1 | 112 | 264 | 3.0E-06 |
sp|A5CEP5|RNH_ORITB | Ribonuclease H OS=Orientia tsutsugamushi (strain Boryong) GN=rnhA PE=3 SV=1 | 112 | 262 | 4.0E-06 |
sp|Q3IIS1|RNH_PSEHT | Ribonuclease H OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rnhA PE=3 SV=1 | 112 | 271 | 5.0E-06 |
sp|Q8D3D3|RNH_WIGBR | Ribonuclease H OS=Wigglesworthia glossinidia brevipalpis GN=rnhA PE=3 SV=1 | 109 | 202 | 9.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0004523 | RNA-DNA hybrid ribonuclease activity | Yes |
GO:0003676 | nucleic acid binding | Yes |
GO:1901363 | heterocyclic compound binding | No |
GO:0004518 | nuclease activity | No |
GO:0140098 | catalytic activity, acting on RNA | No |
GO:0004521 | endoribonuclease activity | No |
GO:0016788 | hydrolase activity, acting on ester bonds | No |
GO:0016787 | hydrolase activity | No |
GO:0003824 | catalytic activity | No |
GO:0140640 | catalytic activity, acting on a nucleic acid | No |
GO:0004519 | endonuclease activity | No |
GO:0097159 | organic cyclic compound binding | No |
GO:0004540 | ribonuclease activity | No |
GO:0005488 | binding | No |
GO:0016893 | endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters | No |
GO:0003674 | molecular_function | No |
GO:0016891 | endoribonuclease activity, producing 5'-phosphomonoesters | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
Yes | 1 - 20 | 0.45 |
Expression values
Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
---|---|---|---|---|
Casing | Casing mycelium | 60.76 | 34.59 | 86.92 |
Initials | Initials knots | 21.10 | 10.56 | 31.63 |
Pileal_Stipeal_center | Stage I stipe center | 8.55 | 3.65 | 13.45 |
Pileal_Stipeal_shell | Stage I stipe shell | 6.92 | 2.91 | 10.93 |
DIF_stipe_center | Stage II stipe center | 7.97 | 3.45 | 12.49 |
DIF_stipe_shell | Stage II stipe shell | 9.26 | 4.07 | 14.45 |
DIF_stipe_skin | Stage II stipe skin | 11.07 | 5.04 | 17.11 |
DIF_cap_skin | Stage II cap skin | 7.10 | 2.94 | 11.26 |
DIF_cap_tissue | Stage II cap tissue | 4.92 | 1.91 | 7.92 |
DIF_gill_tissue | Stage II gill tissue | 6.22 | 2.50 | 9.94 |
YFB_stipe_center | Young fruiting body stipe center | 21.25 | 10.62 | 31.89 |
YFB_stipe_shell | Young fruiting body stipe shell | 15.18 | 7.23 | 23.12 |
YFB_stipe_skin | Young fruiting body stipe skin | 13.52 | 6.33 | 20.70 |
YFB_cap_skin | Young fruiting body cap skin | 4.89 | 1.91 | 7.87 |
YFB_cap_tissue | Young fruiting body cap tissue | 3.07 | 1.04 | 5.09 |
YFB_gill_tissue | Young fruiting body gill tissue | 8.64 | 3.62 | 13.66 |
YFB_veil | Young fruiting body veil | 6.93 | 2.93 | 10.93 |
Differential expression
Label1 | Label2 | Q-value | Significant difference |
---|---|---|---|
Casing | DIF_gill_tissue | 0.000613 | yes |
Casing | YFB_stipe_center | 0.000613 | yes |
Casing | YFB_stipe_shell | 0.000613 | yes |
Casing | YFB_stipe_skin | 0.000613 | yes |
Casing | YFB_cap_skin | 0.000613 | yes |
Casing | YFB_cap_tissue | 0.000613 | yes |
Casing | YFB_gill_tissue | 0.000613 | yes |
Casing | YFB_veil | 0.000613 | yes |
Casing | Initials | 0.000613 | yes |
Casing | Pileal_Stipeal_center | 0.000613 | yes |
Casing | Pileal_Stipeal_shell | 0.000613 | yes |
Casing | DIF_stipe_center | 0.000613 | yes |
Casing | DIF_stipe_shell | 0.000613 | yes |
Casing | DIF_stipe_skin | 0.000613 | yes |
Casing | DIF_cap_skin | 0.000613 | yes |
Casing | DIF_cap_tissue | 0.000613 | yes |
DIF_gill_tissue | YFB_stipe_center | 0.000613 | yes |
DIF_gill_tissue | YFB_stipe_shell | 0.018896 | yes |
DIF_gill_tissue | YFB_stipe_skin | 0.042909 | yes |
DIF_gill_tissue | YFB_cap_skin | 0.693003 | no |
DIF_gill_tissue | YFB_cap_tissue | 0.113653 | no |
DIF_gill_tissue | YFB_gill_tissue | 0.523560 | no |
DIF_gill_tissue | YFB_veil | 0.881203 | no |
YFB_stipe_center | YFB_stipe_shell | 0.433593 | no |
YFB_stipe_center | YFB_stipe_skin | 0.235601 | no |
YFB_stipe_center | YFB_cap_skin | 0.000613 | yes |
YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
YFB_stipe_center | YFB_gill_tissue | 0.006387 | yes |
YFB_stipe_center | YFB_veil | 0.000613 | yes |
YFB_stipe_shell | YFB_stipe_skin | 0.851128 | no |
YFB_stipe_shell | YFB_cap_skin | 0.002951 | yes |
YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
YFB_stipe_shell | YFB_gill_tissue | 0.149200 | no |
YFB_stipe_shell | YFB_veil | 0.031088 | yes |
YFB_stipe_skin | YFB_cap_skin | 0.005302 | yes |
YFB_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
YFB_stipe_skin | YFB_gill_tissue | 0.285827 | no |
YFB_stipe_skin | YFB_veil | 0.077517 | no |
YFB_cap_skin | YFB_cap_tissue | 0.354556 | no |
YFB_cap_skin | YFB_gill_tissue | 0.184591 | no |
YFB_cap_skin | YFB_veil | 0.498538 | no |
YFB_cap_tissue | YFB_gill_tissue | 0.010728 | yes |
YFB_cap_tissue | YFB_veil | 0.051318 | no |
YFB_gill_tissue | YFB_veil | 0.702021 | no |
Initials | DIF_gill_tissue | 0.001625 | yes |
Initials | YFB_stipe_center | 0.991415 | no |
Initials | YFB_stipe_shell | 0.449920 | no |
Initials | YFB_stipe_skin | 0.244275 | no |
Initials | YFB_cap_skin | 0.000613 | yes |
Initials | YFB_cap_tissue | 0.000613 | yes |
Initials | YFB_gill_tissue | 0.008121 | yes |
Initials | YFB_veil | 0.000613 | yes |
Initials | Pileal_Stipeal_center | 0.010093 | yes |
Initials | Pileal_Stipeal_shell | 0.002084 | yes |
Initials | DIF_stipe_center | 0.006387 | yes |
Initials | DIF_stipe_shell | 0.022111 | yes |
Initials | DIF_stipe_skin | 0.069578 | no |
Initials | DIF_cap_skin | 0.001625 | yes |
Initials | DIF_cap_tissue | 0.000613 | yes |
Pileal_Stipeal_center | DIF_gill_tissue | 0.545954 | no |
Pileal_Stipeal_center | YFB_stipe_center | 0.009773 | yes |
Pileal_Stipeal_center | YFB_stipe_shell | 0.137864 | no |
Pileal_Stipeal_center | YFB_stipe_skin | 0.273347 | no |
Pileal_Stipeal_center | YFB_cap_skin | 0.201633 | no |
Pileal_Stipeal_center | YFB_cap_tissue | 0.012577 | yes |
Pileal_Stipeal_center | YFB_gill_tissue | 0.988399 | no |
Pileal_Stipeal_center | YFB_veil | 0.718881 | no |
Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.715442 | no |
Pileal_Stipeal_center | DIF_stipe_center | 0.924984 | no |
Pileal_Stipeal_center | DIF_stipe_shell | 0.910503 | no |
Pileal_Stipeal_center | DIF_stipe_skin | 0.621873 | no |
Pileal_Stipeal_center | DIF_cap_skin | 0.761377 | no |
Pileal_Stipeal_center | DIF_cap_tissue | 0.206115 | no |
Pileal_Stipeal_shell | DIF_gill_tissue | 0.883160 | no |
Pileal_Stipeal_shell | YFB_stipe_center | 0.000613 | yes |
Pileal_Stipeal_shell | YFB_stipe_shell | 0.028437 | yes |
Pileal_Stipeal_shell | YFB_stipe_skin | 0.079479 | no |
Pileal_Stipeal_shell | YFB_cap_skin | 0.500671 | no |
Pileal_Stipeal_shell | YFB_cap_tissue | 0.047584 | yes |
Pileal_Stipeal_shell | YFB_gill_tissue | 0.699718 | no |
Pileal_Stipeal_shell | YFB_veil | 0.997061 | no |
Pileal_Stipeal_shell | DIF_stipe_center | 0.829371 | no |
Pileal_Stipeal_shell | DIF_stipe_shell | 0.579436 | no |
Pileal_Stipeal_shell | DIF_stipe_skin | 0.272049 | no |
Pileal_Stipeal_shell | DIF_cap_skin | 0.971687 | no |
Pileal_Stipeal_shell | DIF_cap_tissue | 0.510756 | no |
DIF_stipe_center | DIF_gill_tissue | 0.665514 | no |
DIF_stipe_center | YFB_stipe_center | 0.005671 | yes |
DIF_stipe_center | YFB_stipe_shell | 0.090496 | no |
DIF_stipe_center | YFB_stipe_skin | 0.191927 | no |
DIF_stipe_center | YFB_cap_skin | 0.284060 | no |
DIF_stipe_center | YFB_cap_tissue | 0.020260 | yes |
DIF_stipe_center | YFB_gill_tissue | 0.914704 | no |
DIF_stipe_center | YFB_veil | 0.832369 | no |
DIF_stipe_center | DIF_stipe_shell | 0.814860 | no |
DIF_stipe_center | DIF_stipe_skin | 0.502497 | no |
DIF_stipe_center | DIF_cap_skin | 0.867800 | no |
DIF_stipe_center | DIF_cap_tissue | 0.295336 | no |
DIF_stipe_shell | DIF_gill_tissue | 0.415213 | no |
DIF_stipe_shell | YFB_stipe_center | 0.019169 | yes |
DIF_stipe_shell | YFB_stipe_shell | 0.225157 | no |
DIF_stipe_shell | YFB_stipe_skin | 0.394970 | no |
DIF_stipe_shell | YFB_cap_skin | 0.129695 | no |
DIF_stipe_shell | YFB_cap_tissue | 0.005671 | yes |
DIF_stipe_shell | YFB_gill_tissue | 0.927842 | no |
DIF_stipe_shell | YFB_veil | 0.582206 | no |
DIF_stipe_shell | DIF_stipe_skin | 0.767934 | no |
DIF_stipe_shell | DIF_cap_skin | 0.625780 | no |
DIF_stipe_shell | DIF_cap_tissue | 0.133711 | no |
DIF_stipe_skin | DIF_gill_tissue | 0.170751 | no |
DIF_stipe_skin | YFB_stipe_center | 0.068461 | no |
DIF_stipe_skin | YFB_stipe_shell | 0.498900 | no |
DIF_stipe_skin | YFB_stipe_skin | 0.711374 | no |
DIF_stipe_skin | YFB_cap_skin | 0.032978 | yes |
DIF_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
DIF_stipe_skin | YFB_gill_tissue | 0.642259 | no |
DIF_stipe_skin | YFB_veil | 0.276999 | no |
DIF_stipe_skin | DIF_cap_skin | 0.311370 | no |
DIF_stipe_skin | DIF_cap_tissue | 0.035537 | yes |
DIF_cap_skin | DIF_gill_tissue | 0.850214 | no |
DIF_cap_skin | YFB_stipe_center | 0.001625 | yes |
DIF_cap_skin | YFB_stipe_shell | 0.038278 | yes |
DIF_cap_skin | YFB_stipe_skin | 0.085045 | no |
DIF_cap_skin | YFB_cap_skin | 0.454917 | no |
DIF_cap_skin | YFB_cap_tissue | 0.044844 | yes |
DIF_cap_skin | YFB_gill_tissue | 0.746788 | no |
DIF_cap_skin | YFB_veil | 0.975790 | no |
DIF_cap_skin | DIF_cap_tissue | 0.467137 | no |
DIF_cap_tissue | DIF_gill_tissue | 0.701820 | no |
DIF_cap_tissue | YFB_stipe_center | 0.000613 | yes |
DIF_cap_tissue | YFB_stipe_shell | 0.003365 | yes |
DIF_cap_tissue | YFB_stipe_skin | 0.005671 | yes |
DIF_cap_tissue | YFB_cap_skin | 0.995589 | no |
DIF_cap_tissue | YFB_cap_tissue | 0.349727 | no |
DIF_cap_tissue | YFB_gill_tissue | 0.189640 | no |
DIF_cap_tissue | YFB_veil | 0.509061 | no |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|111050 MPRLILVSLILELWWTIFTTLQDDPNFVRWTIQYKYYAECANNTCSMRYCFAIDCLTTNIEHTFIAMSYRLFVPP PFADTSRDGLLVQTKRGRLFTNIYHIRGGVKKRSQHIAVFVDGACRGNGYLGARAGMGVYFGPRSRHNISQRLDD DGPQTSQRAEINAAILALDRVKSLLDQDRLETDLVVIASDSEYLVTGISKWIYKWYDNGWTNAKGGDVSNREDFE ELDELVDELEDDYGVFVKFWKVDREDNEEADELAKDAVADEDSTSDDSD* |
Coding | >AgabiH97|111050 ATGCCCCGCCTGATCCTCGTGTCTTTAATACTCGAGTTGTGGTGGACTATTTTTACTACACTACAAGATGACCCC AATTTTGTCAGATGGACTATACAGTATAAATACTATGCAGAATGTGCAAACAACACCTGCTCAATGCGTTATTGC TTCGCTATCGATTGTTTGACCACTAACATCGAACACACATTTATCGCTATGTCGTATCGCCTATTCGTACCTCCC CCTTTTGCCGACACGTCTCGAGATGGCCTTCTCGTTCAAACTAAACGGGGAAGACTTTTCACGAATATTTATCAT ATTCGTGGAGGCGTAAAAAAGCGCAGTCAACATATCGCTGTATTTGTTGATGGTGCTTGTCGAGGCAATGGATAC TTAGGGGCTCGTGCAGGAATGGGAGTTTATTTCGGCCCGCGTTCGCGCCATAATATATCACAACGCCTAGATGAT GACGGTCCACAAACCAGTCAACGCGCAGAAATTAATGCCGCCATTCTTGCTCTCGATCGGGTCAAATCCCTTTTA GACCAGGATAGGTTGGAAACCGATTTGGTTGTAATTGCATCAGATTCCGAGTACCTGGTAACTGGTATATCGAAG TGGATTTATAAATGGTATGATAACGGATGGACGAACGCGAAAGGTGGAGATGTGTCGAATAGAGAGGATTTTGAA GAATTGGACGAGTTGGTCGATGAACTTGAAGATGACTATGGAGTTTTTGTGAAATTTTGGAAGGTAGACAGGGAA GACAACGAGGAGGCCGATGAATTGGCCAAGGATGCAGTAGCAGACGAGGATAGCACGAGCGATGACTCCGATTAA |
Transcript | >AgabiH97|111050 ATGCCCCGCCTGATCCTCGTGTCTTTAATACTCGAGTTGTGGTGGACTATTTTTACTACACTACAAGATGACCCC AATTTTGTCAGATGGACTATACAGTATAAATACTATGCAGAATGTGCAAACAACACCTGCTCAATGCGTTATTGC TTCGCTATCGATTGTTTGACCACTAACATCGAACACACATTTATCGCTATGTCGTATCGCCTATTCGTACCTCCC CCTTTTGCCGACACGTCTCGAGATGGCCTTCTCGTTCAAACTAAACGGGGAAGACTTTTCACGAATATTTATCAT ATTCGTGGAGGCGTAAAAAAGCGCAGTCAACATATCGCTGTATTTGTTGATGGTGCTTGTCGAGGCAATGGATAC TTAGGGGCTCGTGCAGGAATGGGAGTTTATTTCGGCCCGCGTTCGCGCCATAATATATCACAACGCCTAGATGAT GACGGTCCACAAACCAGTCAACGCGCAGAAATTAATGCCGCCATTCTTGCTCTCGATCGGGTCAAATCCCTTTTA GACCAGGATAGGTTGGAAACCGATTTGGTTGTAATTGCATCAGATTCCGAGTACCTGGTAACTGGTATATCGAAG TGGATTTATAAATGGTATGATAACGGATGGACGAACGCGAAAGGTGGAGATGTGTCGAATAGAGAGGATTTTGAA GAATTGGACGAGTTGGTCGATGAACTTGAAGATGACTATGGAGTTTTTGTGAAATTTTGGAAGGTAGACAGGGAA GACAACGAGGAGGCCGATGAATTGGCCAAGGATGCAGTAGCAGACGAGGATAGCACGAGCGATGACTCCGATTAA |
Gene | >AgabiH97|111050 ATGCCCCGCCTGATCCTCGTGTCTTTAATACTCGAGTTGTGGTGGACTATTTTTACTACACTACAAGATGACCCC AATTTTGTCAGATGGACTGTAAGGCTCACATAGACTAGTTATGATTCGACTCGTAGCTAAATGACTCATGTAGAT ACAGTATAAATACTATGCAGAATGTGGTAGTTTAAGTTTGGGATCAACCTTTTGTTGCCCTCACTTCTCTCGACT TGATTACTATCTGTTTTGATCATTTGTTCTAGCAAACAACACCGTCAGTATTCATTAATCATTTGTCTATCTTCG GAGTTTCAATAACCAAAGTGCTCAATGCGTTATTGCTTCGCTATCGATTGTTTGACCACTAACATCGAACACACA TTTATCGCTATGTCGTATCGCCTATTCGTACCTCCCCCTTTTGCCGACACGTCTCGAGATGGCCTTCTCGTTCAA ACTAAACGGGGAAGACTTTTCACGAATATTTATCATATTCGTGGAGGCGTAAAAAAGCGCAGTCAACATATCGCT GTATTTGTTGATGGTGCTTGTCGAGGCAATGGATACTTAGGGGCTCGTGCAGGAATGGGAGTTTATTTCGGCCCG CGTTCGCGCCATAATATATCACAACGCCTAGATGATGACGGTCCACAAACCAGTCAACGCGCAGAAATTAATGCC GCCATTCTTGCTCTCGATCGGGTCAAATCCCTTTTAGACCAGGATAGGTTGGAAACCGATTTGGTTGTAATTGCA TCAGATTCCGAGTACCTGGTAACTGGTATATCGAAGTGGATTTATAAATGGTATGATAACGGATGGACGAACGCG AAAGGTGGAGATGTGTCGAATAGAGAGGATTTTGAAGAATTGGACGAGTTGGTCGATGAACTTGAAGATGACTAT GGAGTTTTTGTGAAATTTTGGAAGGTAGACAGGGAAGACAACGAGGAGGCCGATGAATTGGCCAAGGATGCAGTA GCAGACGAGGATAGCACGAGCGATGACTCCGATTAA |