Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|111050
Gene name
Locationscaffold_8:1283017..1284028
Strand-
Gene length (bp)1011
Transcript length (bp)825
Coding sequence length (bp)825
Protein length (aa) 275

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00075 RNase_H RNase H 8.3E-26 111 263

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BK46|RNH1_RAT Ribonuclease H1 OS=Rattus norvegicus GN=Rnaseh1 PE=2 SV=1 110 267 2.0E-24
sp|O70338|RNH1_MOUSE Ribonuclease H1 OS=Mus musculus GN=Rnaseh1 PE=2 SV=1 110 267 5.0E-24
sp|O60930|RNH1_HUMAN Ribonuclease H1 OS=Homo sapiens GN=RNASEH1 PE=1 SV=2 112 267 7.0E-22
sp|A4IYE6|RNH_FRATW Ribonuclease H OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rnhA PE=3 SV=1 107 265 3.0E-15
sp|Q0BMB7|RNH_FRATO Ribonuclease H OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rnhA PE=3 SV=1 107 265 3.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BK46|RNH1_RAT Ribonuclease H1 OS=Rattus norvegicus GN=Rnaseh1 PE=2 SV=1 110 267 2.0E-24
sp|O70338|RNH1_MOUSE Ribonuclease H1 OS=Mus musculus GN=Rnaseh1 PE=2 SV=1 110 267 5.0E-24
sp|O60930|RNH1_HUMAN Ribonuclease H1 OS=Homo sapiens GN=RNASEH1 PE=1 SV=2 112 267 7.0E-22
sp|A4IYE6|RNH_FRATW Ribonuclease H OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rnhA PE=3 SV=1 107 265 3.0E-15
sp|Q0BMB7|RNH_FRATO Ribonuclease H OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rnhA PE=3 SV=1 107 265 3.0E-15
sp|A0Q6W0|RNH_FRATN Ribonuclease H OS=Francisella tularensis subsp. novicida (strain U112) GN=rnhA PE=3 SV=1 107 265 3.0E-15
sp|B2SFV9|RNH_FRATM Ribonuclease H OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rnhA PE=3 SV=1 107 265 3.0E-15
sp|Q2A3X6|RNH_FRATH Ribonuclease H OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rnhA PE=3 SV=1 107 265 3.0E-15
sp|A7NBM9|RNH_FRATF Ribonuclease H OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rnhA PE=3 SV=1 107 265 3.0E-15
sp|Q14IN1|RNH_FRAT1 Ribonuclease H OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rnhA PE=3 SV=2 107 265 3.0E-15
sp|B0TZ91|RNH_FRAP2 Ribonuclease H OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rnhA PE=3 SV=1 104 265 9.0E-15
sp|B6JJ39|RNH_OLICO Ribonuclease H OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rnhA PE=3 SV=1 111 265 4.0E-14
sp|Q74BH0|RNH_GEOSL Ribonuclease H OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rnhA PE=3 SV=1 109 263 4.0E-14
sp|Q985W1|RNH_RHILO Ribonuclease H OS=Rhizobium loti (strain MAFF303099) GN=rnhA PE=3 SV=1 109 264 5.0E-14
sp|A5G5F6|RNH_GEOUR Ribonuclease H OS=Geobacter uraniireducens (strain Rf4) GN=rnhA PE=3 SV=1 112 263 6.0E-14
sp|Q1QH30|RNH_NITHX Ribonuclease H OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rnhA PE=3 SV=1 111 264 7.0E-14
sp|Q3A827|RNH_PELCD Ribonuclease H OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rnhA PE=3 SV=1 112 269 9.0E-14
sp|A5UFU3|RNH_HAEIG Ribonuclease H OS=Haemophilus influenzae (strain PittGG) GN=rnhA PE=3 SV=1 109 272 1.0E-13
sp|Q4QP49|RNH_HAEI8 Ribonuclease H OS=Haemophilus influenzae (strain 86-028NP) GN=rnhA PE=3 SV=1 109 272 1.0E-13
sp|A0LGJ7|RNH_SYNFM Ribonuclease H OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rnhA PE=3 SV=1 110 263 2.0E-13
sp|Q3SP51|RNH_NITWN Ribonuclease H OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rnhA PE=3 SV=1 111 264 2.0E-13
sp|A4Z216|RNH_BRASO Ribonuclease H OS=Bradyrhizobium sp. (strain ORS278) GN=rnhA PE=3 SV=1 112 264 3.0E-13
sp|P43807|RNH_HAEIN Ribonuclease HI OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rnhA PE=3 SV=1 110 272 3.0E-13
sp|A3MZE1|RNH_ACTP2 Ribonuclease H OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rnhA PE=3 SV=1 112 260 4.0E-13
sp|Q0AE34|RNH_NITEC Ribonuclease H OS=Nitrosomonas eutropha (strain C91) GN=rnhA PE=3 SV=1 105 263 4.0E-13
sp|A5EXP9|RNH_DICNV Ribonuclease H OS=Dichelobacter nodosus (strain VCS1703A) GN=rnhA PE=3 SV=1 114 263 1.0E-12
sp|A5EAL2|RNH_BRASB Ribonuclease H OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rnhA PE=3 SV=1 112 264 1.0E-12
sp|B5Y1G2|RNH_KLEP3 Ribonuclease H OS=Klebsiella pneumoniae (strain 342) GN=rnhA PE=3 SV=1 110 272 1.0E-12
sp|P0A2B9|RNH_SALTY Ribonuclease HI OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rnhA PE=3 SV=1 110 273 1.0E-12
sp|P0A2C0|RNH_SALTI Ribonuclease HI OS=Salmonella typhi GN=rnhA PE=3 SV=1 110 273 1.0E-12
sp|B4TYH0|RNH_SALSV Ribonuclease H OS=Salmonella schwarzengrund (strain CVM19633) GN=rnhA PE=3 SV=1 110 273 1.0E-12
sp|B5BDW5|RNH_SALPK Ribonuclease H OS=Salmonella paratyphi A (strain AKU_12601) GN=rnhA PE=3 SV=1 110 273 1.0E-12
sp|A9MZ19|RNH_SALPB Ribonuclease H OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rnhA PE=3 SV=1 110 273 1.0E-12
sp|Q5PFD8|RNH_SALPA Ribonuclease H OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rnhA PE=3 SV=1 110 273 1.0E-12
sp|B4SV39|RNH_SALNS Ribonuclease H OS=Salmonella newport (strain SL254) GN=rnhA PE=3 SV=1 110 273 1.0E-12
sp|B4TK85|RNH_SALHS Ribonuclease H OS=Salmonella heidelberg (strain SL476) GN=rnhA PE=3 SV=1 110 273 1.0E-12
sp|B5R5L3|RNH_SALG2 Ribonuclease H OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rnhA PE=3 SV=1 110 273 1.0E-12
sp|B5R449|RNH_SALEP Ribonuclease H OS=Salmonella enteritidis PT4 (strain P125109) GN=rnhA PE=3 SV=1 110 273 1.0E-12
sp|B5FJ58|RNH_SALDC Ribonuclease H OS=Salmonella dublin (strain CT_02021853) GN=rnhA PE=3 SV=1 110 273 1.0E-12
sp|Q57SZ6|RNH_SALCH Ribonuclease H OS=Salmonella choleraesuis (strain SC-B67) GN=rnhA PE=3 SV=2 110 273 1.0E-12
sp|A9MPF1|RNH_SALAR Ribonuclease H OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rnhA PE=3 SV=1 110 273 1.0E-12
sp|B5F8X2|RNH_SALA4 Ribonuclease H OS=Salmonella agona (strain SL483) GN=rnhA PE=3 SV=1 110 273 1.0E-12
sp|A4W6V4|RNH_ENT38 Ribonuclease H OS=Enterobacter sp. (strain 638) GN=rnhA PE=3 SV=1 109 265 1.0E-12
sp|Q5F7K9|RNH_NEIG1 Ribonuclease H OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rnhA PE=3 SV=1 112 264 2.0E-12
sp|A7MY21|RNH_VIBCB Ribonuclease H OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rnhA PE=3 SV=1 109 273 2.0E-12
sp|C0Q6N2|RNH_SALPC Ribonuclease H OS=Salmonella paratyphi C (strain RKS4594) GN=rnhA PE=3 SV=1 110 273 2.0E-12
sp|A6VMP9|RNH_ACTSZ Ribonuclease H OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rnhA PE=3 SV=1 110 273 2.0E-12
sp|Q0AMI4|RNH_MARMM Ribonuclease H OS=Maricaulis maris (strain MCS10) GN=rnhA PE=3 SV=1 112 265 2.0E-12
sp|Q82XV8|RNH_NITEU Ribonuclease H OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rnhA PE=3 SV=1 112 272 2.0E-12
sp|Q493H7|RNH_BLOPB Ribonuclease H OS=Blochmannia pennsylvanicus (strain BPEN) GN=rnhA PE=3 SV=1 112 263 2.0E-12
sp|O69014|RNH_ZYMMO Ribonuclease H OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rnhA PE=3 SV=1 112 263 3.0E-12
sp|A6T512|RNH_KLEP7 Ribonuclease H OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rnhA PE=3 SV=1 110 264 3.0E-12
sp|A4SPI4|RNH_AERS4 Ribonuclease H OS=Aeromonas salmonicida (strain A449) GN=rnhA PE=3 SV=1 110 271 3.0E-12
sp|C0R2X2|RNH_WOLWR Ribonuclease H OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=rnhA PE=3 SV=1 110 265 3.0E-12
sp|Q2G9E3|RNH_NOVAD Ribonuclease H OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rnhA PE=3 SV=1 110 263 3.0E-12
sp|Q73K21|RNH_TREDE Ribonuclease H OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rnhA PE=3 SV=1 111 263 3.0E-12
sp|Q9JYE5|RNH_NEIMB Ribonuclease HI OS=Neisseria meningitidis serogroup B (strain MC58) GN=rnhA PE=3 SV=1 109 264 4.0E-12
sp|Q8DM24|RNH_THEEB Ribonuclease H OS=Thermosynechococcus elongatus (strain BP-1) GN=rnhA PE=3 SV=1 113 234 4.0E-12
sp|B0TRM1|RNH_SHEHH Ribonuclease H OS=Shewanella halifaxensis (strain HAW-EB4) GN=rnhA PE=3 SV=1 110 273 4.0E-12
sp|Q87MG2|RNH_VIBPA Ribonuclease HI OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rnhA PE=3 SV=1 109 273 4.0E-12
sp|Q9JTD9|RNH_NEIMA Ribonuclease HI OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rnhA PE=3 SV=1 109 264 4.0E-12
sp|Q31H49|RNH_THICR Ribonuclease H OS=Thiomicrospira crunogena (strain XCL-2) GN=rnhA PE=3 SV=1 110 263 4.0E-12
sp|B6EJV2|RNH_ALISL Ribonuclease H OS=Aliivibrio salmonicida (strain LFI1238) GN=rnhA PE=3 SV=1 110 273 4.0E-12
sp|A1KV38|RNH_NEIMF Ribonuclease H OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rnhA PE=3 SV=1 112 264 5.0E-12
sp|Q1MKH6|RNH_RHIL3 Ribonuclease H OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rnhA PE=3 SV=1 110 263 6.0E-12
sp|Q2KBL2|RNH_RHIEC Ribonuclease H OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rnhA PE=3 SV=1 110 263 6.0E-12
sp|Q92RG0|RNH_RHIME Ribonuclease H OS=Rhizobium meliloti (strain 1021) GN=rnhA PE=3 SV=1 110 263 8.0E-12
sp|A7MI34|RNH_CROS8 Ribonuclease H OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rnhA PE=3 SV=1 110 263 8.0E-12
sp|Q7N807|RNH_PHOLL Ribonuclease H OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rnhA PE=3 SV=1 109 271 8.0E-12
sp|A1S6T0|RNH_SHEAM Ribonuclease H OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rnhA PE=3 SV=1 110 271 9.0E-12
sp|Q7VQB6|RNH_BLOFL Ribonuclease H OS=Blochmannia floridanus GN=rnhA PE=3 SV=1 110 263 9.0E-12
sp|Q16AK0|RNH_ROSDO Ribonuclease H OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rnhA PE=3 SV=1 114 264 1.0E-11
sp|Q5QZL3|RNH_IDILO Ribonuclease H OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rnhA PE=3 SV=1 109 273 1.0E-11
sp|Q65S82|RNH_MANSM Ribonuclease H OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rnhA PE=3 SV=1 110 272 1.0E-11
sp|Q8GF77|RNH_PHOLU Ribonuclease H OS=Photorhabdus luminescens GN=rnhA PE=3 SV=1 109 271 1.0E-11
sp|Q7MII6|RNH_VIBVY Ribonuclease H OS=Vibrio vulnificus (strain YJ016) GN=rnhA PE=3 SV=1 109 273 1.0E-11
sp|Q8DBD5|RNH_VIBVU Ribonuclease HI OS=Vibrio vulnificus (strain CMCP6) GN=rnhA PE=3 SV=1 109 273 1.0E-11
sp|Q3J7D4|RNH_NITOC Ribonuclease H OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rnhA PE=3 SV=1 112 265 2.0E-11
sp|Q73I74|RNH_WOLPM Ribonuclease H OS=Wolbachia pipientis wMel GN=rnhA PE=3 SV=1 110 265 2.0E-11
sp|Q7VM15|RNH_HAEDU Ribonuclease HI OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rnhA PE=3 SV=1 112 260 2.0E-11
sp|Q5E3G5|RNH_VIBF1 Ribonuclease H OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rnhA PE=3 SV=1 110 273 2.0E-11
sp|P57813|RNH_PASMU Ribonuclease HI OS=Pasteurella multocida (strain Pm70) GN=rnhA PE=3 SV=1 109 271 2.0E-11
sp|A7HQX4|RNH_PARL1 Ribonuclease H OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rnhA PE=3 SV=1 112 264 2.0E-11
sp|C5BEV5|RNH_EDWI9 Ribonuclease H OS=Edwardsiella ictaluri (strain 93-146) GN=rnhA PE=3 SV=1 110 273 3.0E-11
sp|A8AKR0|RNH_CITK8 Ribonuclease H OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rnhA PE=3 SV=1 110 265 3.0E-11
sp|A7GAG3|RNH_CLOBL Ribonuclease H OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rnhA PE=3 SV=1 110 263 3.0E-11
sp|A5HYU6|RNH_CLOBH Ribonuclease H OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rnhA PE=3 SV=1 110 263 3.0E-11
sp|A7FR34|RNH_CLOB1 Ribonuclease H OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rnhA PE=3 SV=1 110 263 3.0E-11
sp|A1AT66|RNH_PELPD Ribonuclease H OS=Pelobacter propionicus (strain DSM 2379) GN=rnhA PE=3 SV=1 112 265 4.0E-11
sp|C3LPN8|RNH_VIBCM Ribonuclease H OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rnhA PE=3 SV=1 109 272 4.0E-11
sp|Q9KPX8|RNH_VIBCH Ribonuclease HI OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rnhA PE=3 SV=1 109 272 4.0E-11
sp|A5F633|RNH_VIBC3 Ribonuclease H OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rnhA PE=3 SV=1 109 272 4.0E-11
sp|Q88FF5|RNH_PSEPK Ribonuclease HI OS=Pseudomonas putida (strain KT2440) GN=rnhA PE=3 SV=1 109 263 4.0E-11
sp|B0KN00|RNH_PSEPG Ribonuclease H OS=Pseudomonas putida (strain GB-1) GN=rnhA PE=3 SV=1 109 263 4.0E-11
sp|A5W169|RNH_PSEP1 Ribonuclease H OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rnhA PE=3 SV=1 109 263 4.0E-11
sp|Q5PBQ8|RNH_ANAMM Ribonuclease H OS=Anaplasma marginale (strain St. Maries) GN=rnhA PE=3 SV=2 110 263 4.0E-11
sp|A4VLR0|RNH_PSEU5 Ribonuclease H OS=Pseudomonas stutzeri (strain A1501) GN=rnhA PE=3 SV=1 112 263 5.0E-11
sp|A6V705|RNH_PSEA7 Ribonuclease H OS=Pseudomonas aeruginosa (strain PA7) GN=rnhA PE=3 SV=1 109 265 6.0E-11
sp|Q5NYP6|RNH_AROAE Ribonuclease H OS=Aromatoleum aromaticum (strain EbN1) GN=rnhA PE=3 SV=1 112 263 6.0E-11
sp|B8HPS9|RNH_CYAP4 Ribonuclease H OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rnhA PE=3 SV=1 114 230 6.0E-11
sp|Q12MM4|RNH_SHEDO Ribonuclease H OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rnhA PE=3 SV=1 110 263 6.0E-11
sp|Q2NVF9|RNH_SODGM Ribonuclease H OS=Sodalis glossinidius (strain morsitans) GN=rnhA PE=3 SV=1 110 263 6.0E-11
sp|Q8UHA7|RNH_AGRFC Ribonuclease H OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rnhA PE=3 SV=1 110 263 6.0E-11
sp|A6WWG8|RNH_OCHA4 Ribonuclease H OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rnhA PE=3 SV=1 110 263 7.0E-11
sp|A7ZWF6|RNH_ECOHS Ribonuclease H OS=Escherichia coli O9:H4 (strain HS) GN=rnhA PE=3 SV=1 110 265 7.0E-11
sp|B7LHC0|RNH_ECO55 Ribonuclease H OS=Escherichia coli (strain 55989 / EAEC) GN=rnhA PE=3 SV=1 110 265 7.0E-11
sp|Q0TLC3|RNH_ECOL5 Ribonuclease H OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rnhA PE=3 SV=1 110 265 7.0E-11
sp|B7UJB0|RNH_ECO27 Ribonuclease H OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rnhA PE=3 SV=1 110 265 7.0E-11
sp|Q3Z5E9|RNH_SHISS Ribonuclease H OS=Shigella sonnei (strain Ss046) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|P0A7Y7|RNH_SHIFL Ribonuclease HI OS=Shigella flexneri GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|Q32JP9|RNH_SHIDS Ribonuclease H OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|Q325T2|RNH_SHIBS Ribonuclease H OS=Shigella boydii serotype 4 (strain Sb227) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|B2U352|RNH_SHIB3 Ribonuclease H OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|B7LW89|RNH_ESCF3 Ribonuclease H OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|B1LHM3|RNH_ECOSM Ribonuclease H OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|B6HZS7|RNH_ECOSE Ribonuclease H OS=Escherichia coli (strain SE11) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|B7N876|RNH_ECOLU Ribonuclease H OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|P0A7Y4|RNH_ECOLI Ribonuclease HI OS=Escherichia coli (strain K12) GN=rnhA PE=1 SV=1 110 265 8.0E-11
sp|B1IPU4|RNH_ECOLC Ribonuclease H OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|P0A7Y5|RNH_ECOL6 Ribonuclease HI OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|B1XD78|RNH_ECODH Ribonuclease H OS=Escherichia coli (strain K12 / DH10B) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|C4ZRV1|RNH_ECOBW Ribonuclease H OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|B7M213|RNH_ECO8A Ribonuclease H OS=Escherichia coli O8 (strain IAI1) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|B7MQ23|RNH_ECO81 Ribonuclease H OS=Escherichia coli O81 (strain ED1a) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|B7NKW4|RNH_ECO7I Ribonuclease H OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|B5Z0I8|RNH_ECO5E Ribonuclease H OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|P0A7Y6|RNH_ECO57 Ribonuclease HI OS=Escherichia coli O157:H7 GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|B7MBJ0|RNH_ECO45 Ribonuclease H OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|A7ZHV1|RNH_ECO24 Ribonuclease H OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rnhA PE=3 SV=1 110 265 8.0E-11
sp|Q9I2S9|RNH_PSEAE Ribonuclease HI OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rnhA PE=3 SV=1 109 265 8.0E-11
sp|Q02KV8|RNH_PSEAB Ribonuclease H OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rnhA PE=3 SV=1 109 265 8.0E-11
sp|B7VB62|RNH_PSEA8 Ribonuclease H OS=Pseudomonas aeruginosa (strain LESB58) GN=rnhA PE=3 SV=1 109 265 8.0E-11
sp|Q4KBI1|RNH_PSEF5 Ribonuclease H OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rnhA PE=3 SV=1 109 263 9.0E-11
sp|B4EUG3|RNH_PROMH Ribonuclease H OS=Proteus mirabilis (strain HI4320) GN=rnhA PE=3 SV=1 110 273 9.0E-11
sp|A0KXS6|RNH_SHESA Ribonuclease H OS=Shewanella sp. (strain ANA-3) GN=rnhA PE=3 SV=1 112 273 9.0E-11
sp|A6U6V5|RNH_SINMW Ribonuclease H OS=Sinorhizobium medicae (strain WSM419) GN=rnhA PE=3 SV=1 110 263 1.0E-10
sp|C6DC65|RNH_PECCP Ribonuclease H OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rnhA PE=3 SV=1 110 264 1.0E-10
sp|A3PMR3|RNH_RHOS1 Ribonuclease H OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rnhA PE=3 SV=1 114 264 1.0E-10
sp|A3QET0|RNH_SHELP Ribonuclease H OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rnhA PE=3 SV=1 110 271 1.0E-10
sp|A4WNV1|RNH_RHOS5 Ribonuclease H OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rnhA PE=3 SV=1 114 264 1.0E-10
sp|Q9UST8|RNH1_SCHPO Ribonuclease H OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnh1 PE=1 SV=1 114 265 2.0E-10
sp|Q0VQ76|RNH_ALCBS Ribonuclease H OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rnhA PE=3 SV=1 110 263 2.0E-10
sp|Q3BWP3|RNH_XANC5 Ribonuclease H OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rnhA PE=3 SV=1 112 270 2.0E-10
sp|Q5WWW5|RNH_LEGPL Ribonuclease H OS=Legionella pneumophila (strain Lens) GN=rnhA PE=3 SV=1 112 231 2.0E-10
sp|A9L0F2|RNH_SHEB9 Ribonuclease H OS=Shewanella baltica (strain OS195) GN=rnhA PE=3 SV=1 112 271 2.0E-10
sp|A6WMW8|RNH_SHEB8 Ribonuclease H OS=Shewanella baltica (strain OS185) GN=rnhA PE=3 SV=1 112 271 2.0E-10
sp|A3D440|RNH_SHEB5 Ribonuclease H OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rnhA PE=3 SV=1 112 271 2.0E-10
sp|B8E599|RNH_SHEB2 Ribonuclease H OS=Shewanella baltica (strain OS223) GN=rnhA PE=3 SV=1 112 271 2.0E-10
sp|A8GA77|RNH_SERP5 Ribonuclease H OS=Serratia proteamaculans (strain 568) GN=rnhA PE=3 SV=1 110 272 2.0E-10
sp|B1JBN1|RNH_PSEPW Ribonuclease H OS=Pseudomonas putida (strain W619) GN=rnhA PE=3 SV=1 109 263 2.0E-10
sp|A9IQR5|RNH_BART1 Ribonuclease H OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rnhA PE=3 SV=1 112 265 2.0E-10
sp|Q9PBI6|RNH_XYLFA Ribonuclease HI OS=Xylella fastidiosa (strain 9a5c) GN=rnhA PE=3 SV=2 110 269 2.0E-10
sp|A0KIK4|RNH_AERHH Ribonuclease H OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rnhA PE=3 SV=1 110 271 2.0E-10
sp|A8FUS8|RNH_SHESH Ribonuclease H OS=Shewanella sediminis (strain HAW-EB3) GN=rnhA PE=3 SV=1 110 271 2.0E-10
sp|Q87C76|RNH_XYLFT Ribonuclease HI OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rnhA PE=3 SV=1 112 269 2.0E-10
sp|Q47FN9|RNH_DECAR Ribonuclease H OS=Dechloromonas aromatica (strain RCB) GN=rnhA PE=3 SV=1 112 265 3.0E-10
sp|Q1LL89|RNH_CUPMC Ribonuclease H OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rnhA PE=3 SV=1 110 265 3.0E-10
sp|Q0HI86|RNH_SHESM Ribonuclease H OS=Shewanella sp. (strain MR-4) GN=rnhA PE=3 SV=1 112 273 3.0E-10
sp|Q48KX6|RNH_PSE14 Ribonuclease H OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rnhA PE=3 SV=1 109 263 3.0E-10
sp|Q0HUI2|RNH_SHESR Ribonuclease H OS=Shewanella sp. (strain MR-7) GN=rnhA PE=3 SV=1 112 273 3.0E-10
sp|Q8EE30|RNH_SHEON Ribonuclease HI OS=Shewanella oneidensis (strain MR-1) GN=rnhA PE=1 SV=1 112 273 3.0E-10
sp|B1KHK0|RNH_SHEWM Ribonuclease H OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rnhA PE=3 SV=1 110 272 4.0E-10
sp|Q89UU3|RNH_BRADU Ribonuclease H OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rnhA PE=3 SV=1 112 263 4.0E-10
sp|Q11KC5|RNH_CHESB Ribonuclease H OS=Chelativorans sp. (strain BNC1) GN=rnhA PE=3 SV=1 110 264 4.0E-10
sp|B2S2V0|RNH_TREPS Ribonuclease H OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rnhA PE=3 SV=1 112 263 4.0E-10
sp|O83372|RNH_TREPA Ribonuclease H OS=Treponema pallidum (strain Nichols) GN=rnhA PE=3 SV=1 112 263 4.0E-10
sp|B0T025|RNH_CAUSK Ribonuclease H OS=Caulobacter sp. (strain K31) GN=rnhA PE=3 SV=1 112 260 4.0E-10
sp|Q5UPY1|RNH_MIMIV Probable ribonuclease H OS=Acanthamoeba polyphaga mimivirus GN=RNH1 PE=3 SV=1 122 263 4.0E-10
sp|A4T6Y5|RNH_MYCGI Ribonuclease H OS=Mycobacterium gilvum (strain PYR-GCK) GN=rnhA PE=3 SV=1 112 270 5.0E-10
sp|A1WXD7|RNH_HALHL Ribonuclease H OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rnhA PE=3 SV=1 112 263 5.0E-10
sp|A1RK75|RNH_SHESW Ribonuclease H OS=Shewanella sp. (strain W3-18-1) GN=rnhA PE=3 SV=1 112 273 5.0E-10
sp|A4Y6C1|RNH_SHEPC Ribonuclease H OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rnhA PE=3 SV=1 112 273 5.0E-10
sp|B4S5K2|RNH_PROA2 Ribonuclease H OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rnhA PE=3 SV=1 110 265 5.0E-10
sp|B2VHJ5|RNH_ERWT9 Ribonuclease H OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rnhA PE=3 SV=1 110 265 5.0E-10
sp|A4XU11|RNH_PSEMY Ribonuclease H OS=Pseudomonas mendocina (strain ymp) GN=rnhA PE=3 SV=1 112 263 6.0E-10
sp|Q5H426|RNH_XANOR Ribonuclease H OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rnhA PE=3 SV=1 110 270 6.0E-10
sp|Q2P6Y2|RNH_XANOM Ribonuclease H OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rnhA PE=3 SV=1 110 270 6.0E-10
sp|B7VIP1|RNH_VIBTL Ribonuclease H OS=Vibrio tasmaniensis (strain LGP32) GN=rnhA PE=3 SV=1 109 273 7.0E-10
sp|Q7NYL8|RNH_CHRVO Ribonuclease H OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rnhA PE=3 SV=1 112 263 8.0E-10
sp|B3QM41|RNH_CHLP8 Ribonuclease H OS=Chlorobaculum parvum (strain NCIB 8327) GN=rnhA PE=3 SV=1 112 267 8.0E-10
sp|A1AW38|RNH_RUTMC Ribonuclease H OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rnhA PE=3 SV=1 112 263 8.0E-10
sp|Q2LWY9|RNH_SYNAS Ribonuclease H OS=Syntrophus aciditrophicus (strain SB) GN=rnhA PE=3 SV=1 105 271 8.0E-10
sp|Q1QW64|RNH_CHRSD Ribonuclease H OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rnhA PE=3 SV=1 112 266 1.0E-09
sp|Q1I7T4|RNH_PSEE4 Ribonuclease H OS=Pseudomonas entomophila (strain L48) GN=rnhA PE=3 SV=1 109 263 1.0E-09
sp|A1BE10|RNH_CHLPD Ribonuclease H OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rnhA PE=3 SV=1 110 265 1.0E-09
sp|Q2ND39|RNH_ERYLH Ribonuclease H OS=Erythrobacter litoralis (strain HTCC2594) GN=rnhA PE=3 SV=1 110 263 1.0E-09
sp|Q87YT0|RNH_PSESM Ribonuclease HI OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rnhA PE=3 SV=1 109 263 1.0E-09
sp|Q5ZVQ7|RNH_LEGPH Ribonuclease H OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rnhA PE=3 SV=1 112 231 1.0E-09
sp|A5IBM5|RNH_LEGPC Ribonuclease H OS=Legionella pneumophila (strain Corby) GN=rnhA PE=3 SV=1 112 231 1.0E-09
sp|Q5X5I2|RNH_LEGPA Ribonuclease H OS=Legionella pneumophila (strain Paris) GN=rnhA PE=3 SV=1 112 231 1.0E-09
sp|Q83EK3|RNH_COXBU Ribonuclease H OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rnhA PE=3 SV=1 107 263 1.0E-09
sp|A9NB52|RNH_COXBR Ribonuclease H OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rnhA PE=3 SV=1 107 263 1.0E-09
sp|B6J5V1|RNH_COXB1 Ribonuclease H OS=Coxiella burnetii (strain CbuK_Q154) GN=rnhA PE=3 SV=1 105 263 1.0E-09
sp|A9KGQ0|RNH_COXBN Ribonuclease H OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rnhA PE=3 SV=1 105 263 1.0E-09
sp|B6J1Y7|RNH_COXB2 Ribonuclease H OS=Coxiella burnetii (strain CbuG_Q212) GN=rnhA PE=3 SV=1 105 263 1.0E-09
sp|Q4ZVL1|RNH_PSEU2 Ribonuclease H OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rnhA PE=3 SV=1 109 263 1.0E-09
sp|A1URX4|RNH_BARBK Ribonuclease H OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rnhA PE=3 SV=1 112 265 2.0E-09
sp|P66674|RNH_BRUSU Ribonuclease HI OS=Brucella suis biovar 1 (strain 1330) GN=rnhA PE=3 SV=1 110 263 2.0E-09
sp|B0CKG2|RNH_BRUSI Ribonuclease H OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rnhA PE=3 SV=1 110 263 2.0E-09
sp|A5VP47|RNH_BRUO2 Ribonuclease H OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rnhA PE=3 SV=1 110 263 2.0E-09
sp|P66673|RNH_BRUME Ribonuclease HI OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rnhA PE=3 SV=1 110 263 2.0E-09
sp|Q57EP4|RNH_BRUAB Ribonuclease H OS=Brucella abortus biovar 1 (strain 9-941) GN=rnhA PE=3 SV=1 110 263 2.0E-09
sp|Q2YMI3|RNH_BRUA2 Ribonuclease H OS=Brucella abortus (strain 2308) GN=rnhA PE=3 SV=1 110 263 2.0E-09
sp|B1JR46|RNH_YERPY Ribonuclease H OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rnhA PE=3 SV=1 109 263 2.0E-09
sp|Q667M7|RNH_YERPS Ribonuclease H OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rnhA PE=3 SV=1 109 263 2.0E-09
sp|A4TL54|RNH_YERPP Ribonuclease H OS=Yersinia pestis (strain Pestoides F) GN=rnhA PE=3 SV=1 109 263 2.0E-09
sp|Q1CFI6|RNH_YERPN Ribonuclease H OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rnhA PE=3 SV=1 109 263 2.0E-09
sp|A9R0G0|RNH_YERPG Ribonuclease H OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rnhA PE=3 SV=1 109 263 2.0E-09
sp|Q8ZH30|RNH_YERPE Ribonuclease HI OS=Yersinia pestis GN=rnhA PE=3 SV=1 109 263 2.0E-09
sp|B2KAC9|RNH_YERPB Ribonuclease H OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rnhA PE=3 SV=1 109 263 2.0E-09
sp|Q1CAJ5|RNH_YERPA Ribonuclease H OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rnhA PE=3 SV=1 109 263 2.0E-09
sp|A7FFK7|RNH_YERP3 Ribonuclease H OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rnhA PE=3 SV=1 109 263 2.0E-09
sp|Q8PBX8|RNH_XANCP Ribonuclease H OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rnhA PE=3 SV=1 112 261 2.0E-09
sp|Q4URM3|RNH_XANC8 Ribonuclease H OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rnhA PE=3 SV=1 112 261 2.0E-09
sp|C4LC60|RNH_TOLAT Ribonuclease H OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rnhA PE=3 SV=1 110 263 2.0E-09
sp|A1VMW5|RNH_POLNA Ribonuclease H OS=Polaromonas naphthalenivorans (strain CJ2) GN=rnhA PE=3 SV=1 108 263 2.0E-09
sp|Q1LT02|RNH_BAUCH Ribonuclease H OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rnhA PE=3 SV=1 112 272 2.0E-09
sp|A4SXM6|RNH_POLSQ Ribonuclease H OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rnhA PE=3 SV=1 111 265 2.0E-09
sp|Q46Z81|RNH_CUPPJ Ribonuclease H OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rnhA PE=3 SV=1 110 265 2.0E-09
sp|Q3SIB2|RNH_THIDA Ribonuclease H OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rnhA PE=3 SV=1 112 263 2.0E-09
sp|A3DD79|RNH_CLOTH Ribonuclease H OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rnhA PE=3 SV=1 110 263 2.0E-09
sp|A1W6Q8|RNH_ACISJ Ribonuclease H OS=Acidovorax sp. (strain JS42) GN=rnhA PE=3 SV=1 111 263 2.0E-09
sp|B3EH35|RNH_CHLL2 Ribonuclease H OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rnhA PE=3 SV=1 105 265 3.0E-09
sp|Q2W9A9|RNH_MAGSA Ribonuclease H OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rnhA PE=3 SV=1 108 265 3.0E-09
sp|Q6D1V7|RNH_PECAS Ribonuclease H OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rnhA PE=3 SV=1 110 264 3.0E-09
sp|B7JVG1|RNH_CYAP8 Ribonuclease H OS=Cyanothece sp. (strain PCC 8801) GN=rnhA PE=3 SV=1 110 272 3.0E-09
sp|Q15TA7|RNH_PSEA6 Ribonuclease H OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rnhA PE=3 SV=1 110 273 4.0E-09
sp|Q081L4|RNH_SHEFN Ribonuclease H OS=Shewanella frigidimarina (strain NCIMB 400) GN=rnhA PE=3 SV=1 110 271 4.0E-09
sp|B3Q6U1|RNH_RHOPT Ribonuclease H OS=Rhodopseudomonas palustris (strain TIE-1) GN=rnhA PE=3 SV=1 112 265 4.0E-09
sp|Q6N1Y3|RNH_RHOPA Ribonuclease H OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rnhA PE=3 SV=1 112 265 4.0E-09
sp|A4SFZ9|RNH_CHLPM Ribonuclease H OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rnhA PE=3 SV=1 110 263 4.0E-09
sp|Q3KE77|RNH_PSEPF Ribonuclease H OS=Pseudomonas fluorescens (strain Pf0-1) GN=rnhA PE=3 SV=1 112 263 4.0E-09
sp|Q28V43|RNH_JANSC Ribonuclease H OS=Jannaschia sp. (strain CCS1) GN=rnhA PE=3 SV=1 112 264 5.0E-09
sp|A2C030|RNH_PROM1 Ribonuclease H OS=Prochlorococcus marinus (strain NATL1A) GN=rnhA PE=3 SV=1 106 228 6.0E-09
sp|A5CX29|RNH_VESOH Ribonuclease H OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rnhA PE=3 SV=1 110 263 6.0E-09
sp|B3EMT1|RNH_CHLPB Ribonuclease H OS=Chlorobium phaeobacteroides (strain BS1) GN=rnhA PE=3 SV=1 110 265 6.0E-09
sp|Q46HH3|RNH_PROMT Ribonuclease H OS=Prochlorococcus marinus (strain NATL2A) GN=rnhA PE=3 SV=1 106 259 6.0E-09
sp|A1JKB1|RNH_YERE8 Ribonuclease H OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rnhA PE=3 SV=1 109 263 7.0E-09
sp|Q131J2|RNH_RHOPS Ribonuclease H OS=Rhodopseudomonas palustris (strain BisB5) GN=rnhA PE=3 SV=1 112 263 7.0E-09
sp|Q1GDG1|RNH_RUEST Ribonuclease H OS=Ruegeria sp. (strain TM1040) GN=rnhA PE=3 SV=1 114 273 8.0E-09
sp|Q5LNJ2|RNH_RUEPO Ribonuclease H OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rnhA PE=3 SV=1 114 263 8.0E-09
sp|Q8PNH8|RNH_XANAC Ribonuclease H OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rnhA PE=3 SV=1 112 261 9.0E-09
sp|Q2GHJ9|RNH_EHRCR Ribonuclease H OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rnhA PE=3 SV=1 105 264 9.0E-09
sp|A6SXA4|RNH_JANMA Ribonuclease H OS=Janthinobacterium sp. (strain Marseille) GN=rnhA PE=3 SV=1 112 228 1.0E-08
sp|Q8XZ91|RNH_RALSO Ribonuclease H OS=Ralstonia solanacearum (strain GMI1000) GN=rnhA PE=3 SV=1 110 263 1.0E-08
sp|A1TQI7|RNH_ACIAC Ribonuclease H OS=Acidovorax citrulli (strain AAC00-1) GN=rnhA PE=3 SV=1 111 263 2.0E-08
sp|Q7WCJ8|RNH_BORBR Ribonuclease H OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rnhA PE=3 SV=1 109 263 2.0E-08
sp|Q07705|RNH_MYCSM Ribonuclease H OS=Mycobacterium smegmatis GN=rnhA PE=3 SV=2 112 273 2.0E-08
sp|A0R3Q8|RNH_MYCS2 Ribonuclease H OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rnhA PE=3 SV=1 112 273 2.0E-08
sp|Q2J0F8|RNH_RHOP2 Ribonuclease H OS=Rhodopseudomonas palustris (strain HaA2) GN=rnhA PE=3 SV=1 112 265 2.0E-08
sp|B4R8T3|RNH_PHEZH Ribonuclease H OS=Phenylobacterium zucineum (strain HLK1) GN=rnhA PE=3 SV=1 112 265 2.0E-08
sp|Q5FG88|RNH_EHRRG Ribonuclease H OS=Ehrlichia ruminantium (strain Gardel) GN=rnhA PE=3 SV=2 105 264 3.0E-08
sp|Q6G0C8|RNH_BARQU Ribonuclease H OS=Bartonella quintana (strain Toulouse) GN=rnhA PE=3 SV=1 112 265 3.0E-08
sp|Q0AV47|RNH_SYNWW Ribonuclease H OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rnhA PE=3 SV=1 110 263 3.0E-08
sp|Q60AW8|RNH_METCA Ribonuclease H OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rnhA PE=3 SV=1 112 271 3.0E-08
sp|Q0RJ31|RNH_FRAAA Ribonuclease H OS=Frankia alni (strain ACN14a) GN=rnhA PE=3 SV=1 114 273 3.0E-08
sp|A4G7G3|RNH_HERAR Ribonuclease H OS=Herminiimonas arsenicoxydans GN=rnhA PE=3 SV=1 110 228 3.0E-08
sp|Q0C3M1|RNH_HYPNA Ribonuclease H OS=Hyphomonas neptunium (strain ATCC 15444) GN=rnhA PE=3 SV=1 112 263 3.0E-08
sp|Q2Y8K1|RNH_NITMU Ribonuclease H OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rnhA PE=3 SV=1 107 263 3.0E-08
sp|Q0K8W6|RNH_CUPNH Ribonuclease H OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rnhA PE=3 SV=1 110 263 4.0E-08
sp|Q7VRX8|RNH_BORPE Ribonuclease H OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rnhA PE=3 SV=1 109 263 4.0E-08
sp|Q2RPU6|RNH_RHORT Ribonuclease H OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rnhA PE=3 SV=1 112 265 4.0E-08
sp|Q6G4C3|RNH_BARHE Ribonuclease H OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rnhA PE=3 SV=1 112 265 4.0E-08
sp|Q2RKU0|RNH_MOOTA Ribonuclease H OS=Moorella thermoacetica (strain ATCC 39073) GN=rnhA PE=3 SV=1 110 257 5.0E-08
sp|Q0A753|RNH_ALKEH Ribonuclease H OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rnhA PE=3 SV=1 114 263 5.0E-08
sp|Q12B88|RNH_POLSJ Ribonuclease H OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rnhA PE=3 SV=1 112 263 5.0E-08
sp|Q2KV56|RNH_BORA1 Ribonuclease H OS=Bordetella avium (strain 197N) GN=rnhA PE=3 SV=1 112 264 5.0E-08
sp|B5EMD8|RNH_ACIF5 Ribonuclease H OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rnhA PE=3 SV=1 112 227 7.0E-08
sp|B7J4E2|RNH_ACIF2 Ribonuclease H OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rnhA PE=3 SV=1 112 227 7.0E-08
sp|A1B840|RNH_PARDP Ribonuclease H OS=Paracoccus denitrificans (strain Pd 1222) GN=rnhA PE=3 SV=1 114 264 8.0E-08
sp|Q7VDY9|RNH_PROMA Ribonuclease H OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rnhA PE=3 SV=1 105 259 8.0E-08
sp|A1U0U9|RNH_MARHV Ribonuclease H OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rnhA PE=3 SV=1 112 263 9.0E-08
sp|A7HB50|RNH_ANADF Ribonuclease H OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rnhA PE=3 SV=1 115 271 9.0E-08
sp|A8EXT7|RNH_RICCK Ribonuclease H OS=Rickettsia canadensis (strain McKiel) GN=rnhA PE=3 SV=1 112 227 1.0E-07
sp|Q9A341|RNH_CAUCR Ribonuclease HI OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rnhA PE=3 SV=1 109 263 1.0E-07
sp|B8H4W7|RNH_CAUCN Ribonuclease H OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rnhA PE=3 SV=1 109 263 1.0E-07
sp|Q2GDA1|RNH_NEOSM Ribonuclease H OS=Neorickettsia sennetsu (strain Miyayama) GN=rnhA PE=3 SV=1 114 227 1.0E-07
sp|A4FMU3|RNH_SACEN Ribonuclease H OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rnhA PE=3 SV=1 112 259 1.0E-07
sp|Q21YF6|RNH_RHOFT Ribonuclease H OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rnhA PE=3 SV=1 112 231 1.0E-07
sp|A8F2L0|RNH_RICM5 Ribonuclease H OS=Rickettsia massiliae (strain Mtu5) GN=rnhA PE=3 SV=2 112 227 1.0E-07
sp|Q39X47|RNH_GEOMG Ribonuclease H OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rnhA PE=3 SV=1 155 263 1.0E-07
sp|Q4UN27|RNH_RICFE Ribonuclease H OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rnhA PE=3 SV=1 112 227 1.0E-07
sp|Q3B2H0|RNH_CHLL7 Ribonuclease H OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rnhA PE=3 SV=2 110 263 2.0E-07
sp|Q01RW8|RNH_SOLUE Ribonuclease H OS=Solibacter usitatus (strain Ellin6076) GN=rnhA PE=3 SV=1 110 269 2.0E-07
sp|Q9ZCK3|RNH_RICPR Ribonuclease HI OS=Rickettsia prowazekii (strain Madrid E) GN=rnhA PE=3 SV=1 112 227 2.0E-07
sp|Q1H190|RNH_METFK Ribonuclease H OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rnhA PE=3 SV=1 109 263 2.0E-07
sp|A1WFG9|RNH_VEREI Ribonuclease H OS=Verminephrobacter eiseniae (strain EF01-2) GN=rnhA PE=3 SV=1 111 263 2.0E-07
sp|Q92GL5|RNH_RICCN Ribonuclease HI OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rnhA PE=3 SV=2 112 227 2.0E-07
sp|A8GPT6|RNH_RICAH Ribonuclease H OS=Rickettsia akari (strain Hartford) GN=rnhA PE=3 SV=1 112 227 2.0E-07
sp|A8LLC1|RNH_DINSH Ribonuclease H OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rnhA PE=3 SV=1 114 264 3.0E-07
sp|Q07762|RNH1_CRIFA Ribonuclease H OS=Crithidia fasciculata GN=RNH1 PE=3 SV=1 114 239 3.0E-07
sp|Q3YR62|RNH_EHRCJ Ribonuclease H OS=Ehrlichia canis (strain Jake) GN=rnhA PE=3 SV=1 105 230 3.0E-07
sp|A4J7B3|RNH_DESRM Ribonuclease H OS=Desulfotomaculum reducens (strain MI-1) GN=rnhA PE=3 SV=1 110 271 3.0E-07
sp|A1SS86|RNH_PSYIN Ribonuclease H OS=Psychromonas ingrahamii (strain 37) GN=rnhA PE=3 SV=2 110 272 4.0E-07
sp|Q04740|RNH1_YEAST Ribonuclease H OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH1 PE=1 SV=2 109 208 4.0E-07
sp|Q8RA67|RNH_CALS4 Ribonuclease H OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rnhA PE=3 SV=1 105 263 5.0E-07
sp|Q1RJL7|RNH_RICBR Ribonuclease H OS=Rickettsia bellii (strain RML369-C) GN=rnhA PE=3 SV=1 112 229 6.0E-07
sp|P29253|RNH_THET8 Ribonuclease H OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rnhA PE=1 SV=2 110 269 8.0E-07
sp|Q2SJ45|RNH_HAHCH Ribonuclease H OS=Hahella chejuensis (strain KCTC 2396) GN=rnhA PE=3 SV=1 112 265 8.0E-07
sp|B4UMK8|RNH_ANASK Ribonuclease H OS=Anaeromyxobacter sp. (strain K) GN=rnhA PE=3 SV=1 147 263 9.0E-07
sp|Q2IJL8|RNH_ANADE Ribonuclease H OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rnhA PE=3 SV=1 150 263 1.0E-06
sp|B8J731|RNH_ANAD2 Ribonuclease H OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rnhA PE=3 SV=1 147 263 1.0E-06
sp|Q7UF86|RNH_RHOBA Ribonuclease H OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rnhA PE=3 SV=1 112 262 1.0E-06
sp|Q83GM3|RNH_TROWT Ribonuclease H OS=Tropheryma whipplei (strain Twist) GN=rnhA PE=3 SV=1 165 263 2.0E-06
sp|Q83HK9|RNH_TROW8 Ribonuclease H OS=Tropheryma whipplei (strain TW08/27) GN=rnhA PE=3 SV=1 165 263 2.0E-06
sp|A4XKQ3|RNH_CALS8 Ribonuclease H OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rnhA PE=3 SV=1 110 265 2.0E-06
sp|Q68W20|RNH_RICTY Ribonuclease H OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rnhA PE=3 SV=1 112 264 3.0E-06
sp|A5CEP5|RNH_ORITB Ribonuclease H OS=Orientia tsutsugamushi (strain Boryong) GN=rnhA PE=3 SV=1 112 262 4.0E-06
sp|Q3IIS1|RNH_PSEHT Ribonuclease H OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rnhA PE=3 SV=1 112 271 5.0E-06
sp|Q8D3D3|RNH_WIGBR Ribonuclease H OS=Wigglesworthia glossinidia brevipalpis GN=rnhA PE=3 SV=1 109 202 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004523 RNA-DNA hybrid ribonuclease activity Yes
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0004518 nuclease activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0004521 endoribonuclease activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0004519 endonuclease activity No
GO:0097159 organic cyclic compound binding No
GO:0004540 ribonuclease activity No
GO:0005488 binding No
GO:0016893 endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters No
GO:0003674 molecular_function No
GO:0016891 endoribonuclease activity, producing 5'-phosphomonoesters No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|111050
MPRLILVSLILELWWTIFTTLQDDPNFVRWTIQYKYYAECANNTCSMRYCFAIDCLTTNIEHTFIAMSYRLFVPP
PFADTSRDGLLVQTKRGRLFTNIYHIRGGVKKRSQHIAVFVDGACRGNGYLGARAGMGVYFGPRSRHNISQRLDD
DGPQTSQRAEINAAILALDRVKSLLDQDRLETDLVVIASDSEYLVTGISKWIYKWYDNGWTNAKGGDVSNREDFE
ELDELVDELEDDYGVFVKFWKVDREDNEEADELAKDAVADEDSTSDDSD*
Coding >AgabiH97|111050
ATGCCCCGCCTGATCCTCGTGTCTTTAATACTCGAGTTGTGGTGGACTATTTTTACTACACTACAAGATGACCCC
AATTTTGTCAGATGGACTATACAGTATAAATACTATGCAGAATGTGCAAACAACACCTGCTCAATGCGTTATTGC
TTCGCTATCGATTGTTTGACCACTAACATCGAACACACATTTATCGCTATGTCGTATCGCCTATTCGTACCTCCC
CCTTTTGCCGACACGTCTCGAGATGGCCTTCTCGTTCAAACTAAACGGGGAAGACTTTTCACGAATATTTATCAT
ATTCGTGGAGGCGTAAAAAAGCGCAGTCAACATATCGCTGTATTTGTTGATGGTGCTTGTCGAGGCAATGGATAC
TTAGGGGCTCGTGCAGGAATGGGAGTTTATTTCGGCCCGCGTTCGCGCCATAATATATCACAACGCCTAGATGAT
GACGGTCCACAAACCAGTCAACGCGCAGAAATTAATGCCGCCATTCTTGCTCTCGATCGGGTCAAATCCCTTTTA
GACCAGGATAGGTTGGAAACCGATTTGGTTGTAATTGCATCAGATTCCGAGTACCTGGTAACTGGTATATCGAAG
TGGATTTATAAATGGTATGATAACGGATGGACGAACGCGAAAGGTGGAGATGTGTCGAATAGAGAGGATTTTGAA
GAATTGGACGAGTTGGTCGATGAACTTGAAGATGACTATGGAGTTTTTGTGAAATTTTGGAAGGTAGACAGGGAA
GACAACGAGGAGGCCGATGAATTGGCCAAGGATGCAGTAGCAGACGAGGATAGCACGAGCGATGACTCCGATTAA
Transcript >AgabiH97|111050
ATGCCCCGCCTGATCCTCGTGTCTTTAATACTCGAGTTGTGGTGGACTATTTTTACTACACTACAAGATGACCCC
AATTTTGTCAGATGGACTATACAGTATAAATACTATGCAGAATGTGCAAACAACACCTGCTCAATGCGTTATTGC
TTCGCTATCGATTGTTTGACCACTAACATCGAACACACATTTATCGCTATGTCGTATCGCCTATTCGTACCTCCC
CCTTTTGCCGACACGTCTCGAGATGGCCTTCTCGTTCAAACTAAACGGGGAAGACTTTTCACGAATATTTATCAT
ATTCGTGGAGGCGTAAAAAAGCGCAGTCAACATATCGCTGTATTTGTTGATGGTGCTTGTCGAGGCAATGGATAC
TTAGGGGCTCGTGCAGGAATGGGAGTTTATTTCGGCCCGCGTTCGCGCCATAATATATCACAACGCCTAGATGAT
GACGGTCCACAAACCAGTCAACGCGCAGAAATTAATGCCGCCATTCTTGCTCTCGATCGGGTCAAATCCCTTTTA
GACCAGGATAGGTTGGAAACCGATTTGGTTGTAATTGCATCAGATTCCGAGTACCTGGTAACTGGTATATCGAAG
TGGATTTATAAATGGTATGATAACGGATGGACGAACGCGAAAGGTGGAGATGTGTCGAATAGAGAGGATTTTGAA
GAATTGGACGAGTTGGTCGATGAACTTGAAGATGACTATGGAGTTTTTGTGAAATTTTGGAAGGTAGACAGGGAA
GACAACGAGGAGGCCGATGAATTGGCCAAGGATGCAGTAGCAGACGAGGATAGCACGAGCGATGACTCCGATTAA
Gene >AgabiH97|111050
ATGCCCCGCCTGATCCTCGTGTCTTTAATACTCGAGTTGTGGTGGACTATTTTTACTACACTACAAGATGACCCC
AATTTTGTCAGATGGACTGTAAGGCTCACATAGACTAGTTATGATTCGACTCGTAGCTAAATGACTCATGTAGAT
ACAGTATAAATACTATGCAGAATGTGGTAGTTTAAGTTTGGGATCAACCTTTTGTTGCCCTCACTTCTCTCGACT
TGATTACTATCTGTTTTGATCATTTGTTCTAGCAAACAACACCGTCAGTATTCATTAATCATTTGTCTATCTTCG
GAGTTTCAATAACCAAAGTGCTCAATGCGTTATTGCTTCGCTATCGATTGTTTGACCACTAACATCGAACACACA
TTTATCGCTATGTCGTATCGCCTATTCGTACCTCCCCCTTTTGCCGACACGTCTCGAGATGGCCTTCTCGTTCAA
ACTAAACGGGGAAGACTTTTCACGAATATTTATCATATTCGTGGAGGCGTAAAAAAGCGCAGTCAACATATCGCT
GTATTTGTTGATGGTGCTTGTCGAGGCAATGGATACTTAGGGGCTCGTGCAGGAATGGGAGTTTATTTCGGCCCG
CGTTCGCGCCATAATATATCACAACGCCTAGATGATGACGGTCCACAAACCAGTCAACGCGCAGAAATTAATGCC
GCCATTCTTGCTCTCGATCGGGTCAAATCCCTTTTAGACCAGGATAGGTTGGAAACCGATTTGGTTGTAATTGCA
TCAGATTCCGAGTACCTGGTAACTGGTATATCGAAGTGGATTTATAAATGGTATGATAACGGATGGACGAACGCG
AAAGGTGGAGATGTGTCGAATAGAGAGGATTTTGAAGAATTGGACGAGTTGGTCGATGAACTTGAAGATGACTAT
GGAGTTTTTGTGAAATTTTGGAAGGTAGACAGGGAAGACAACGAGGAGGCCGATGAATTGGCCAAGGATGCAGTA
GCAGACGAGGATAGCACGAGCGATGACTCCGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail