Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|111000
Gene name
Locationscaffold_8:1273284..1274285
Strand+
Gene length (bp)1001
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05176 ATP-synt_10 ATP10 protein 2.0E-58 32 264

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P18496|ATP10_YEAST Mitochondrial ATPase complex subunit ATP10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP10 PE=1 SV=2 26 259 3.0E-24
sp|Q6FWV2|ATP10_CANGA Mitochondrial ATPase complex subunit ATP10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATP10 PE=3 SV=1 34 268 3.0E-22
sp|Q09836|ATP10_SCHPO Probable mitochondrial ATPase complex subunit atp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp10 PE=3 SV=1 46 269 2.0E-19
sp|Q757F3|ATP10_ASHGO Mitochondrial ATPase complex subunit ATP10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATP10 PE=3 SV=2 34 263 1.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|111000
MSLLTWPVRTQTRAFSSSALRRNDPLSSIQGSDAPPTNTLPPLNRPLGVRERPTTLAKTTTARIKELMHTDALME
QRRHLVKEASVGYFHDVNMTRKHGGKTWIAPQVLIREDKALYLPNIAGKVLSDGSTKHTTEMCFGKTTILAMLNT
KVSEINVKGFIDPTHARYASHPLYQCVQVNLQENLLKSFLVNLFLRSLRRVTPKELHSTYLVSSQNMEYVRDALG
MTNARVGYVYLIDENLKIRWGGCADATKEETLALESCTGVLLKRLERKKEMEPHPSTQ*
Coding >AgabiH97|111000
ATGTCTTTGTTGACCTGGCCTGTGCGCACCCAAACACGCGCTTTCTCCTCCTCAGCCCTCCGCCGCAATGACCCC
CTGTCGTCCATCCAGGGTTCAGATGCCCCGCCCACCAACACCCTCCCGCCCCTCAACCGCCCCCTTGGGGTCCGA
GAACGCCCGACGACCCTCGCCAAGACCACCACCGCCCGCATCAAGGAGCTAATGCACACCGACGCACTGATGGAG
CAGCGGAGACATCTAGTAAAAGAAGCCAGTGTCGGCTATTTTCACGATGTGAATATGACTCGCAAACACGGCGGC
AAGACCTGGATAGCACCACAAGTGCTTATCCGTGAGGATAAAGCTCTCTATCTGCCCAACATCGCTGGCAAGGTC
CTCAGCGATGGGTCAACCAAGCACACCACCGAGATGTGCTTTGGCAAAACCACCATACTTGCCATGCTGAACACC
AAAGTTTCAGAGATAAATGTAAAGGGGTTCATTGACCCGACGCATGCGCGTTACGCCTCTCATCCACTGTATCAA
TGTGTGCAAGTGAACCTCCAGGAAAACCTTCTCAAGTCTTTCTTGGTCAATCTCTTCCTAAGGTCCCTGCGGCGG
GTGACGCCAAAGGAGCTGCACTCGACATACTTGGTGTCGAGCCAGAACATGGAATATGTACGAGATGCGCTCGGC
ATGACGAATGCACGAGTCGGCTATGTCTATCTGATTGATGAGAATCTCAAGATTCGGTGGGGCGGATGTGCAGAT
GCAACCAAGGAGGAAACACTAGCTCTGGAGAGCTGCACAGGTGTTCTACTCAAGCGACTGGAGCGCAAAAAAGAA
ATGGAACCACATCCATCGACTCAGTAG
Transcript >AgabiH97|111000
ATGTCTTTGTTGACCTGGCCTGTGCGCACCCAAACACGCGCTTTCTCCTCCTCAGCCCTCCGCCGCAATGACCCC
CTGTCGTCCATCCAGGGTTCAGATGCCCCGCCCACCAACACCCTCCCGCCCCTCAACCGCCCCCTTGGGGTCCGA
GAACGCCCGACGACCCTCGCCAAGACCACCACCGCCCGCATCAAGGAGCTAATGCACACCGACGCACTGATGGAG
CAGCGGAGACATCTAGTAAAAGAAGCCAGTGTCGGCTATTTTCACGATGTGAATATGACTCGCAAACACGGCGGC
AAGACCTGGATAGCACCACAAGTGCTTATCCGTGAGGATAAAGCTCTCTATCTGCCCAACATCGCTGGCAAGGTC
CTCAGCGATGGGTCAACCAAGCACACCACCGAGATGTGCTTTGGCAAAACCACCATACTTGCCATGCTGAACACC
AAAGTTTCAGAGATAAATGTAAAGGGGTTCATTGACCCGACGCATGCGCGTTACGCCTCTCATCCACTGTATCAA
TGTGTGCAAGTGAACCTCCAGGAAAACCTTCTCAAGTCTTTCTTGGTCAATCTCTTCCTAAGGTCCCTGCGGCGG
GTGACGCCAAAGGAGCTGCACTCGACATACTTGGTGTCGAGCCAGAACATGGAATATGTACGAGATGCGCTCGGC
ATGACGAATGCACGAGTCGGCTATGTCTATCTGATTGATGAGAATCTCAAGATTCGGTGGGGCGGATGTGCAGAT
GCAACCAAGGAGGAAACACTAGCTCTGGAGAGCTGCACAGGTGTTCTACTCAAGCGACTGGAGCGCAAAAAAGAA
ATGGAACCACATCCATCGACTCAGTAG
Gene >AgabiH97|111000
ATGTCTTTGTTGACCTGGCCTGTGCGCACCCAAACACGCGCTTTCTCCTCCTCAGCCCTCCGCCGCAATGACCCC
CTGTCGTCCATCCAGGGTTCAGATGCCCCGCCCACCAACACCCTCCCGCCCCTCAACCGCCCCCTTGGGGTCCGA
GAACGCCCGACGACCCTCGCCAAGACCACCACCGCCCGCATCAAGGAGCTAATGCACACCGACGCACTGATGGAG
CAGCGGAGACATCTGTTCGTTACTGTAGTATCTCTACTCGCATGTACATTGACCGTCGTCGTCGTTAGAGTAAAA
GAAGCCAGTGTCGGCTATTTTCACGATGTGAATATGACTCGCAAACACGGCGGCAAGACCTGGATAGCACCACAA
GTGCTTATCCGTGAGGATGTAAGTCTCGCTCATGTGTGCTAGCGCCGATTCCGACTGTCTTCAGAAAGCTCTCTA
TCTGCCCAACATCGCTGGCAAGGTCCTCAGCGATGGGTCAACCAAGCACACCACCGAGATGTGCTTTGGCAAAAC
CACCATACTTGCCATGCTGAACACCAAAGTTTCAGAGGTAGCCTTTTGTTTCTCTCGACAAGTGTTGACGCTGAC
CCGGCTCTTAGATAAATGTAAAGGGGTTCATTGACCCGACGCATGCGCGTTACGCCTCTCATCCACTGTATCAAT
GTGTGCAAGTGAACCTCCAGGAAAACCTTCTCAAGTCTTTCTTGGTCAATCTCTTCCTAAGGTCCCTGCGGCGGG
TGACGCCAAAGGAGCTGCACTCGACATACTTGGTGTCGAGCCAGAACATGGAATATGTACGAGATGCGCTCGGCA
TGACGAATGCACGAGTCGGCTATGTCTATCTGATTGATGAGAATCTCAAGATTCGGTGGGGCGGATGTGCAGATG
CAACCAAGGAGGAAACACTAGCTCTGGAGAGCTGCACAGGTGTTCTACTCAAGCGACTGGAGCGCAAAAAAGAAA
TGGAACCACATCCATCGACTCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail