Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|110920
Gene name
Locationscaffold_8:1247895..1251383
Strand+
Gene length (bp)3488
Transcript length (bp)2421
Coding sequence length (bp)2421
Protein length (aa) 807

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07217 Het-C Heterokaryon incompatibility protein Het-C 9.1E-218 13 573

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 44.16 26.47 61.86
Initials Initials knots 29.89 17.77 42.01
Pileal_Stipeal_center Stage I stipe center 33.29 19.54 47.05
Pileal_Stipeal_shell Stage I stipe shell 37.28 22.19 52.37
DIF_stipe_center Stage II stipe center 26.48 15.64 37.32
DIF_stipe_shell Stage II stipe shell 50.68 30.01 71.35
DIF_stipe_skin Stage II stipe skin 48.89 28.82 68.96
DIF_cap_skin Stage II cap skin 45.40 27.02 63.78
DIF_cap_tissue Stage II cap tissue 29.10 17.30 40.91
DIF_gill_tissue Stage II gill tissue 23.66 13.84 33.48
YFB_stipe_center Young fruiting body stipe center 28.64 16.85 40.43
YFB_stipe_shell Young fruiting body stipe shell 59.17 35.32 83.03
YFB_stipe_skin Young fruiting body stipe skin 62.36 35.98 88.75
YFB_cap_skin Young fruiting body cap skin 44.71 26.64 62.78
YFB_cap_tissue Young fruiting body cap tissue 17.87 10.05 25.68
YFB_gill_tissue Young fruiting body gill tissue 56.89 31.48 82.31
YFB_veil Young fruiting body veil 34.62 20.57 48.67

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.013485 yes
Casing YFB_stipe_center 0.124851 no
Casing YFB_stipe_shell 0.355365 no
Casing YFB_stipe_skin 0.267364 no
Casing YFB_cap_skin 0.981916 no
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.494303 no
Casing YFB_veil 0.478597 no
Casing Initials 0.179578 no
Casing Pileal_Stipeal_center 0.386972 no
Casing Pileal_Stipeal_shell 0.668752 no
Casing DIF_stipe_center 0.056561 no
Casing DIF_stipe_shell 0.741131 no
Casing DIF_stipe_skin 0.824632 no
Casing DIF_cap_skin 0.959650 no
Casing DIF_cap_tissue 0.141946 no
DIF_gill_tissue YFB_stipe_center 0.626740 no
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.015819 yes
DIF_gill_tissue YFB_cap_tissue 0.430967 no
DIF_gill_tissue YFB_gill_tissue 0.000613 yes
DIF_gill_tissue YFB_veil 0.206339 no
YFB_stipe_center YFB_stipe_shell 0.003365 yes
YFB_stipe_center YFB_stipe_skin 0.004548 yes
YFB_stipe_center YFB_cap_skin 0.129397 no
YFB_stipe_center YFB_cap_tissue 0.116571 no
YFB_stipe_center YFB_gill_tissue 0.013485 yes
YFB_stipe_center YFB_veil 0.626514 no
YFB_stipe_shell YFB_stipe_skin 0.923849 no
YFB_stipe_shell YFB_cap_skin 0.396739 no
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.945158 no
YFB_stipe_shell YFB_veil 0.051723 no
YFB_stipe_skin YFB_cap_skin 0.296315 no
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.861742 no
YFB_stipe_skin YFB_veil 0.032038 yes
YFB_cap_skin YFB_cap_tissue 0.000613 yes
YFB_cap_skin YFB_gill_tissue 0.524822 no
YFB_cap_skin YFB_veil 0.450378 no
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.018344 yes
YFB_gill_tissue YFB_veil 0.100249 no
Initials DIF_gill_tissue 0.517429 no
Initials YFB_stipe_center 0.937466 no
Initials YFB_stipe_shell 0.004160 yes
Initials YFB_stipe_skin 0.004160 yes
Initials YFB_cap_skin 0.171403 no
Initials YFB_cap_tissue 0.072510 no
Initials YFB_gill_tissue 0.017507 yes
Initials YFB_veil 0.729738 no
Initials Pileal_Stipeal_center 0.814860 no
Initials Pileal_Stipeal_shell 0.544115 no
Initials DIF_stipe_center 0.782510 no
Initials DIF_stipe_shell 0.048626 yes
Initials DIF_stipe_skin 0.071782 no
Initials DIF_cap_skin 0.145002 no
Initials DIF_cap_tissue 0.963204 no
Pileal_Stipeal_center DIF_gill_tissue 0.286505 no
Pileal_Stipeal_center YFB_stipe_center 0.725954 no
Pileal_Stipeal_center YFB_stipe_shell 0.033211 yes
Pileal_Stipeal_center YFB_stipe_skin 0.021322 yes
Pileal_Stipeal_center YFB_cap_skin 0.374795 no
Pileal_Stipeal_center YFB_cap_tissue 0.026215 yes
Pileal_Stipeal_center YFB_gill_tissue 0.068640 no
Pileal_Stipeal_center YFB_veil 0.943618 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.806492 no
Pileal_Stipeal_center DIF_stipe_center 0.525018 no
Pileal_Stipeal_center DIF_stipe_shell 0.142929 no
Pileal_Stipeal_center DIF_stipe_skin 0.210546 no
Pileal_Stipeal_center DIF_cap_skin 0.335056 no
Pileal_Stipeal_center DIF_cap_tissue 0.761465 no
Pileal_Stipeal_shell DIF_gill_tissue 0.110389 no
Pileal_Stipeal_shell YFB_stipe_center 0.444501 no
Pileal_Stipeal_shell YFB_stipe_shell 0.096942 no
Pileal_Stipeal_shell YFB_stipe_skin 0.065276 no
Pileal_Stipeal_shell YFB_cap_skin 0.638874 no
Pileal_Stipeal_shell YFB_cap_tissue 0.005671 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.176804 no
Pileal_Stipeal_shell YFB_veil 0.881432 no
Pileal_Stipeal_shell DIF_stipe_center 0.264724 no
Pileal_Stipeal_shell DIF_stipe_shell 0.332993 no
Pileal_Stipeal_shell DIF_stipe_skin 0.420639 no
Pileal_Stipeal_shell DIF_cap_skin 0.600619 no
Pileal_Stipeal_shell DIF_cap_tissue 0.483441 no
DIF_stipe_center DIF_gill_tissue 0.807950 no
DIF_stipe_center YFB_stipe_center 0.873485 no
DIF_stipe_center YFB_stipe_shell 0.000613 yes
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.053765 no
DIF_stipe_center YFB_cap_tissue 0.200916 no
DIF_stipe_center YFB_gill_tissue 0.004160 yes
DIF_stipe_center YFB_veil 0.423761 no
DIF_stipe_center DIF_stipe_shell 0.009123 yes
DIF_stipe_center DIF_stipe_skin 0.021322 yes
DIF_stipe_center DIF_cap_skin 0.045060 yes
DIF_stipe_center DIF_cap_tissue 0.842217 no
DIF_stipe_shell DIF_gill_tissue 0.001140 yes
DIF_stipe_shell YFB_stipe_center 0.036228 yes
DIF_stipe_shell YFB_stipe_shell 0.698351 no
DIF_stipe_shell YFB_stipe_skin 0.583859 no
DIF_stipe_shell YFB_cap_skin 0.772780 no
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.810566 no
DIF_stipe_shell YFB_veil 0.197823 no
DIF_stipe_shell DIF_stipe_skin 0.947685 no
DIF_stipe_shell DIF_cap_skin 0.809319 no
DIF_stipe_shell DIF_cap_tissue 0.035765 yes
DIF_stipe_skin DIF_gill_tissue 0.005302 yes
DIF_stipe_skin YFB_stipe_center 0.055979 no
DIF_stipe_skin YFB_stipe_shell 0.613748 no
DIF_stipe_skin YFB_stipe_skin 0.503573 no
DIF_stipe_skin YFB_cap_skin 0.851498 no
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.738454 no
DIF_stipe_skin YFB_veil 0.265039 no
DIF_stipe_skin DIF_cap_skin 0.880706 no
DIF_stipe_skin DIF_cap_tissue 0.060104 no
DIF_cap_skin DIF_gill_tissue 0.011041 yes
DIF_cap_skin YFB_stipe_center 0.103796 no
DIF_cap_skin YFB_stipe_shell 0.428971 no
DIF_cap_skin YFB_stipe_skin 0.327476 no
DIF_cap_skin YFB_cap_skin 0.977008 no
DIF_cap_skin YFB_cap_tissue 0.000613 yes
DIF_cap_skin YFB_gill_tissue 0.563134 no
DIF_cap_skin YFB_veil 0.418456 no
DIF_cap_skin DIF_cap_tissue 0.115964 no
DIF_cap_tissue DIF_gill_tissue 0.578285 no
DIF_cap_tissue YFB_stipe_center 0.976329 no
DIF_cap_tissue YFB_stipe_shell 0.004160 yes
DIF_cap_tissue YFB_stipe_skin 0.004160 yes
DIF_cap_tissue YFB_cap_skin 0.131993 no
DIF_cap_tissue YFB_cap_tissue 0.094984 no
DIF_cap_tissue YFB_gill_tissue 0.015242 yes
DIF_cap_tissue YFB_veil 0.660228 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|110920
MAVPPTTIFLLLFVLFAFCLSGNGVYAFGAGNIPSFAYMEGKAFRHGDIEDVLAEIVKRAAGGLTAVVSKGSKFN
GLDIKRVYFGNWLRDYSQAVDIASLKKIPMQTIINLCMVLGFLAHGYATHEFEVTPERLGCYLPTEHIDNPKGYG
EGEDARRYHPGLRGPVDPRELEIDPRTGMKNYIANENGSWDTSKALVRRTLERCIHLGRLHRSQSRKQDEYEAYR
LLGQLMHTLEDFPAHSNFCELALVSMGHQHVFVHVGDNVRIQAPNGKWVAPIVTGTFGSNDFIHSLLGEATDHLS
EASVTDLNRELDHARSKSIESTARSGPGGGNDVASTLRGMFTSLPGGAGGDLSRDMDSIERIRAGPAAGGKRPED
MSPQELHAVLWQVLTFRDSVVKKISKTIEKIPGLGPLIEKIQDGISVFVFTTLEPFLKPILKTATTSLSAASGEI
IDTHDQYEVFNDPRASDPTHSFLSKDHFNLILNEPAGRVGRVIVQHTVGLVVKAWDNNSENVHAITEDILQCLFH
PDFHNSNSKIQRAMLQTVNEWVQGLGKKQRSVLSRLDKNSVREHQNVRAAGEGGAAPAQGSYAQTQGVGVQHTIA
GYAQNIPGAQTVFSATGFGKVKPGQREFPPSSAGGLPPSSYSGASGGYPSHTGPPPTSSYSDAHTHHNPYPPPSE
PRQPPQRAGYAPSYVSPPPQSYNAPPAPPASSFPGFPGSAPVMSAYGTPSYPPASAPPPSFPGEAGGGFGFPSAP
GGPPEPFGGAVGGQPPPPFGFPSVEPLGGSSPYGVPNQPQGHHHPHEHHHQRPPGW*
Coding >AgabiH97|110920
ATGGCCGTGCCTCCCACCACCATCTTCTTGCTGCTCTTTGTTCTCTTTGCCTTCTGCCTCTCCGGCAATGGCGTC
TATGCCTTTGGCGCCGGAAACATCCCCTCGTTCGCTTACATGGAGGGCAAAGCCTTCCGCCACGGCGATATCGAA
GATGTCCTTGCCGAGATCGTCAAGCGCGCAGCGGGCGGCCTCACGGCAGTGGTCAGCAAGGGATCCAAATTTAAC
GGTCTTGATATCAAGCGCGTCTACTTTGGGAACTGGCTTCGCGATTACAGTCAGGCTGTCGACATAGCGTCACTC
AAAAAGATTCCTATGCAGACAATCATCAACCTGTGCATGGTCCTTGGCTTCCTTGCTCACGGTTATGCGACTCAC
GAGTTCGAAGTGACCCCCGAGCGATTGGGTTGCTATCTTCCGACTGAGCACATTGACAACCCAAAGGGCTACGGT
GAAGGTGAAGATGCGAGGAGATACCATCCAGGCCTCCGAGGCCCCGTCGACCCGCGCGAGCTTGAAATCGATCCT
CGCACTGGTATGAAGAATTACATTGCTAATGAAAATGGTTCTTGGGATACTTCCAAAGCCCTTGTTCGACGTACC
CTTGAACGCTGCATTCATCTCGGTCGCCTTCATCGTTCGCAAAGCAGGAAACAAGATGAATATGAAGCATACAGA
CTTCTCGGTCAGCTTATGCACACTCTAGAAGATTTTCCTGCCCATTCCAATTTTTGCGAGCTGGCTCTCGTTTCT
ATGGGCCATCAGCATGTGTTCGTTCATGTCGGTGACAATGTCAGAATACAAGCTCCGAACGGCAAATGGGTCGCT
CCAATTGTCACTGGAACTTTTGGATCGAATGATTTCATTCATTCACTCCTTGGAGAGGCCACCGACCATCTGAGT
GAAGCGTCAGTGACGGATTTAAACCGTGAACTTGATCACGCCAGATCAAAATCAATCGAGAGCACCGCTCGCTCG
GGCCCTGGAGGTGGTAACGATGTAGCGTCTACCCTTCGCGGCATGTTCACTTCCCTTCCCGGTGGTGCTGGGGGG
GATTTGAGCAGAGACATGGACTCCATCGAAAGGATACGAGCTGGACCAGCTGCTGGTGGGAAAAGGCCAGAAGAT
ATGAGTCCCCAAGAGTTGCACGCCGTACTCTGGCAAGTATTGACATTCAGAGATTCAGTCGTGAAAAAGATTTCG
AAAACAATTGAGAAGATTCCTGGATTAGGACCCTTGATCGAAAAAATACAAGATGGGATATCTGTCTTTGTCTTT
ACGACTCTCGAGCCCTTCCTGAAACCTATATTGAAAACGGCCACCACCAGCTTGTCAGCAGCTTCAGGAGAGATC
ATCGATACCCATGATCAGTATGAAGTTTTTAACGATCCTCGTGCCTCCGATCCGACGCATTCTTTCCTGAGCAAA
GATCATTTTAATTTAATTCTAAATGAACCCGCTGGTAGAGTCGGCAGAGTAATAGTACAGCACACTGTCGGACTT
GTGGTGAAGGCTTGGGACAATAATTCGGAGAACGTCCACGCAATCACTGAAGACATCCTCCAATGTTTGTTCCAC
CCCGACTTTCACAATTCCAACTCAAAGATCCAACGTGCCATGCTCCAAACAGTGAATGAATGGGTGCAAGGTCTT
GGGAAGAAGCAGCGCAGTGTTTTAAGCCGTCTCGACAAGAATTCGGTGAGAGAACACCAGAATGTTCGCGCTGCA
GGGGAAGGTGGTGCGGCCCCCGCACAGGGCTCGTATGCACAGACCCAAGGAGTCGGAGTCCAACATACTATTGCT
GGATACGCGCAGAACATTCCCGGAGCGCAGACAGTCTTCAGTGCTACTGGATTTGGCAAGGTGAAACCTGGACAG
AGAGAGTTTCCGCCATCTAGCGCAGGGGGTCTTCCGCCTAGCTCGTATAGTGGTGCATCAGGCGGGTACCCTTCT
CACACAGGTCCTCCGCCAACTTCATCCTATTCGGATGCCCACACGCATCATAATCCGTATCCTCCGCCATCTGAG
CCACGGCAGCCGCCACAGCGCGCTGGATATGCACCTTCCTATGTTTCCCCTCCTCCACAGTCGTACAACGCGCCC
CCTGCGCCTCCCGCGTCTTCATTCCCTGGCTTCCCAGGCTCGGCACCTGTTATGTCTGCGTACGGTACGCCAAGT
TACCCCCCTGCTAGTGCACCACCCCCTTCGTTCCCCGGGGAAGCTGGAGGTGGATTTGGTTTCCCCTCTGCGCCT
GGTGGGCCTCCAGAACCGTTTGGAGGTGCGGTTGGCGGTCAACCACCACCACCTTTTGGTTTCCCGTCGGTTGAA
CCGCTCGGCGGCTCATCACCCTATGGAGTCCCTAACCAACCGCAAGGACATCATCATCCACATGAACATCACCAC
CAGAGGCCACCCGGCTGGTAA
Transcript >AgabiH97|110920
ATGGCCGTGCCTCCCACCACCATCTTCTTGCTGCTCTTTGTTCTCTTTGCCTTCTGCCTCTCCGGCAATGGCGTC
TATGCCTTTGGCGCCGGAAACATCCCCTCGTTCGCTTACATGGAGGGCAAAGCCTTCCGCCACGGCGATATCGAA
GATGTCCTTGCCGAGATCGTCAAGCGCGCAGCGGGCGGCCTCACGGCAGTGGTCAGCAAGGGATCCAAATTTAAC
GGTCTTGATATCAAGCGCGTCTACTTTGGGAACTGGCTTCGCGATTACAGTCAGGCTGTCGACATAGCGTCACTC
AAAAAGATTCCTATGCAGACAATCATCAACCTGTGCATGGTCCTTGGCTTCCTTGCTCACGGTTATGCGACTCAC
GAGTTCGAAGTGACCCCCGAGCGATTGGGTTGCTATCTTCCGACTGAGCACATTGACAACCCAAAGGGCTACGGT
GAAGGTGAAGATGCGAGGAGATACCATCCAGGCCTCCGAGGCCCCGTCGACCCGCGCGAGCTTGAAATCGATCCT
CGCACTGGTATGAAGAATTACATTGCTAATGAAAATGGTTCTTGGGATACTTCCAAAGCCCTTGTTCGACGTACC
CTTGAACGCTGCATTCATCTCGGTCGCCTTCATCGTTCGCAAAGCAGGAAACAAGATGAATATGAAGCATACAGA
CTTCTCGGTCAGCTTATGCACACTCTAGAAGATTTTCCTGCCCATTCCAATTTTTGCGAGCTGGCTCTCGTTTCT
ATGGGCCATCAGCATGTGTTCGTTCATGTCGGTGACAATGTCAGAATACAAGCTCCGAACGGCAAATGGGTCGCT
CCAATTGTCACTGGAACTTTTGGATCGAATGATTTCATTCATTCACTCCTTGGAGAGGCCACCGACCATCTGAGT
GAAGCGTCAGTGACGGATTTAAACCGTGAACTTGATCACGCCAGATCAAAATCAATCGAGAGCACCGCTCGCTCG
GGCCCTGGAGGTGGTAACGATGTAGCGTCTACCCTTCGCGGCATGTTCACTTCCCTTCCCGGTGGTGCTGGGGGG
GATTTGAGCAGAGACATGGACTCCATCGAAAGGATACGAGCTGGACCAGCTGCTGGTGGGAAAAGGCCAGAAGAT
ATGAGTCCCCAAGAGTTGCACGCCGTACTCTGGCAAGTATTGACATTCAGAGATTCAGTCGTGAAAAAGATTTCG
AAAACAATTGAGAAGATTCCTGGATTAGGACCCTTGATCGAAAAAATACAAGATGGGATATCTGTCTTTGTCTTT
ACGACTCTCGAGCCCTTCCTGAAACCTATATTGAAAACGGCCACCACCAGCTTGTCAGCAGCTTCAGGAGAGATC
ATCGATACCCATGATCAGTATGAAGTTTTTAACGATCCTCGTGCCTCCGATCCGACGCATTCTTTCCTGAGCAAA
GATCATTTTAATTTAATTCTAAATGAACCCGCTGGTAGAGTCGGCAGAGTAATAGTACAGCACACTGTCGGACTT
GTGGTGAAGGCTTGGGACAATAATTCGGAGAACGTCCACGCAATCACTGAAGACATCCTCCAATGTTTGTTCCAC
CCCGACTTTCACAATTCCAACTCAAAGATCCAACGTGCCATGCTCCAAACAGTGAATGAATGGGTGCAAGGTCTT
GGGAAGAAGCAGCGCAGTGTTTTAAGCCGTCTCGACAAGAATTCGGTGAGAGAACACCAGAATGTTCGCGCTGCA
GGGGAAGGTGGTGCGGCCCCCGCACAGGGCTCGTATGCACAGACCCAAGGAGTCGGAGTCCAACATACTATTGCT
GGATACGCGCAGAACATTCCCGGAGCGCAGACAGTCTTCAGTGCTACTGGATTTGGCAAGGTGAAACCTGGACAG
AGAGAGTTTCCGCCATCTAGCGCAGGGGGTCTTCCGCCTAGCTCGTATAGTGGTGCATCAGGCGGGTACCCTTCT
CACACAGGTCCTCCGCCAACTTCATCCTATTCGGATGCCCACACGCATCATAATCCGTATCCTCCGCCATCTGAG
CCACGGCAGCCGCCACAGCGCGCTGGATATGCACCTTCCTATGTTTCCCCTCCTCCACAGTCGTACAACGCGCCC
CCTGCGCCTCCCGCGTCTTCATTCCCTGGCTTCCCAGGCTCGGCACCTGTTATGTCTGCGTACGGTACGCCAAGT
TACCCCCCTGCTAGTGCACCACCCCCTTCGTTCCCCGGGGAAGCTGGAGGTGGATTTGGTTTCCCCTCTGCGCCT
GGTGGGCCTCCAGAACCGTTTGGAGGTGCGGTTGGCGGTCAACCACCACCACCTTTTGGTTTCCCGTCGGTTGAA
CCGCTCGGCGGCTCATCACCCTATGGAGTCCCTAACCAACCGCAAGGACATCATCATCCACATGAACATCACCAC
CAGAGGCCACCCGGCTGGTAA
Gene >AgabiH97|110920
ATGGCCGTGCCTCCCACCACCATCTTCTTGCTGCTCTTTGTTCTCTTTGCCTTCTGCCTCTCCGGCAATGGCGTC
TATGCCTTTGGCGCCGGAAACATCCCCTCGTAAGCCTCCTCCTCACCTCGTGCGCCAAGAAATGATCTCATTACG
CCCCAGGTTCGCTTACATGGAGGGCAAAGCCTTCCGCCACGGCGATATCGTCAGTCCCAACAACAACTGGGTCTC
TCATTAGTTAATAACTCGTAATCTAGGAAGATGTCCTTGCCGAGATCGTCAAGCGCGCAGCGGGCGGCCTCACGG
CAGTGGTCAGCAAGGGATCCAAATTTAACGGTCTTGATATCAAGCGCGTCTACTTTGGGTGCGATCTCTCCTCTT
TAACCTTGACTGTATCTTATCTTCTCGATCGCTCTTTACCTTCAGGAACTGGCTTCGCGATTACAGTCAGGTGAG
CCATCTATGCAGATGTCATTTACGTCACAGATCACTTATTGTATGCGCAGGCTGTCGACATAGCGTCACTCAAAA
AGATTCCTATGCAGGTCTGTTCCCCTCGTTATATCTTCTTTGCGCTGTTTGTTGACTTTCAGTCAGACAATCATC
AACCTGTGCATGGTCCTTGGCTTCCTTGTACGCCCGCAACAGTATTCTCTTGACTCTCATCTGACTAGCTCAGGC
TCACGGTTATGCGACTCACGAGTTCGAAGTGACCCCCGAGCGATTGGGTTGCTATCTTCCGGTGCGCCTGTTGAC
ACTTATCTGCGTTTCCATGCTCAATACCACACAGACTGAGCACATTGACAACCCAAAGGGCTACGGTGAAGGTGA
AGATGCGAGGAGATACCATCCAGGCCTCCGAGGCCCCGTCGACGTGCGTCGCCTCGAGTATATGCATGACAGTTC
TGTACTTAACCTCTTGTACAGCCGCGCGAGCTTGAAATCGATCCTCGCACTGGTATGAAGAATTACATTGCTAAT
GGTATCTTGATGTTCTCGCGTTTCCTGCAACTTTGATTCACGTCATTGCAGAAAATGGTTCTTGGGATACTTCCA
AAGCCCTTGTTCGACGTACCCTTGAACGCTGCATTCATCTCGGTCGCCTTCATCGTTCGCAAAGCAGGAAACAAG
ATGAATATGAAGCATACAGACTTCTCGGTCAGCTTGTGACTACTCTTCACCCTACAGCTGCTCGTGCGTATGCTC
ACGTCGACATTCACCTAGATGCACACTCTAGAAGATTTTCCTGCCCATTCCAATTTTTGCGAGCTGGCTCTCGTT
TCTATGGGCCATCAGCATGTGTTCGTTCATGTCGGTGACAATGTCAGAATACAAGCTCCGAACGGCAAATGGGTC
GCTCCAATTGTCACTGGTCTGCCTGTCTTCGACCTTGTATTTGAGGCATCCTAAACTTCATCACAGGAACTTTTG
GATCGAATGATTTCATTCATTCACTCCTTGGAGGTGCGTGCGTCTTTTTGTGTCCGAGTGCATAACTTTATTAAA
CGTGGAACAGAGGCCACCGACCATCTGGTAAGTTTCTAGCACCAAATCCACACTTTTCCACTTAAGCCTCGTGGG
ACTAATGTTGATTATAGAGTGAAGTAAGTCATTGACATTTATGATCCATAACTGGCCTCATTCCTTACTCCTCAG
GCGTCAGTGACGGATTTAAACCGTGAACTTGATCACGCCAGATCAAAATCAATCGAGAGCACCGCTCGCTCGGGC
CCTGGAGGTGGTAACGATGTAGCGTCTACCCTTCGCGGCATGTTCACTTCCCTTCCCGGTGGTGCTGGGGGGGAT
TTGAGCAGAGACATGGACTCCATCGAAAGGATACGAGCTGGACCAGCTGCTGGTGGGAAAAGGCCAGAAGATATG
AGTCCCCAAGAGTTGCACGCCGTACTCTGGCAAGTATTGACATTCAGAGATTCAGGTAGGCATTCGACGACGTGA
AATAGGCAAAAAAAACTCACGAAAAGTTTTTTAGTCGTGAAAAAGATTTCGAAAACAATTGAGAAGATTCCTGGA
TTAGGACCCTTGATCGAAAAAATACAAGATGGGATATCTGGTGGGTCGCTCTATCATTTATTCCTGAACCTAGTT
CGAATGATCTTTCAGTCTTTGTCTTTACGACTCTCGAGGTATGGCAATCACCGATCACCAATTTATTAGCTCTGA
TTCCGAAATTCAGCCCTTCCTGAAACCTATATTGAAAACGGCCACCACCAGCTTGTCAGCAGCTTCAGGAGAGAT
CATCGATACCCATGATCAGTATGAAGTTTTTAACGATCCTCGTGCCGTACGTTGTGCATATTTTTGAGATGTTAT
CAAACTCACAATCAGCGTAGTCCGATCCGACGCATTCTTTCCTGAGCAAAGATCATTTTGTCAGTTCAATTTTTG
CATGCCACCGAATAGGGCTGACAGTGGCATAGAATTTAATTCTAAATGAACCCGCTGGTAGAGTCGGCAGAGTAA
TAGTACAGCACACTGTCGGACTTGTGGTGAAGGCTTGGGACAATAATTCGGAGAACGTCCACGCAATCACTGAAG
ACATCCTCCAATGTTTGTATGTAGTATTGCCTATTGCCGATGGCTACGAGAGTCCTTGCCTGACGTCATTTTTGC
ATTATTCAAGGTTCCACCCCGACTTTCACAATTCCAACTCAAAGATCCAACGTGCCATGCTCCAAACAGTGAATG
AATGGGTGCAAGGTCTTGGGAAGAAGCAGCGCAGTGTTTTAAGCCGTCTCGACAAGAATTCGGTGAGAGAACACC
AGAATGTTCGCGCTGCAGGGGAAGGTGGTGCGGCCCCCGCACAGGGCTCGTATGCACAGACCCAAGGAGTCGGAG
TCCAACATACTATTGCTGGATACGCGCAGAACATTCCCGGAGCGCAGACAGTCTTCAGTGCTACTGGATTTGGCA
AGGTGAAACCTGGACAGAGAGAGTTTCCGCCATCTAGCGCAGGGGGTCTTCCGCCTAGCTCGTATAGTGGTGCAT
CAGGCGGGTACCCTTCTCACACAGGTCCTCCGCCAACTTCATCCTATTCGGATGCCCACACGCATCATAATCCGT
ATCCTCCGCCATCTGAGCCACGGCAGCCGCCACAGCGCGCTGGATATGCACCTTCCTATGTTTCCCCTCCTCCAC
AGTCGTACAACGCGCCCCCTGCGCCTCCCGCGTCTTCATTCCCTGGCTTCCCAGGCTCGGCACCTGTTATGTCTG
CGTACGGTACGCCAAGTTACCCCCCTGCTAGTGCACCACCCCCTTCGTTCCCCGGGGAAGCTGGAGGTGGATTTG
GTTTCCCCTCTGCGCCTGGTGGGCCTCCAGAACCGTTTGGAGGTGCGGTTGGCGGTCAACCACCACCACCTTTTG
GTTTCCCGTCGGTTGAACCGCTCGGCGGCTCATCACCCTATGGAGTCCCTAACCAACCGCAAGGACATCATCATC
CACATGAACATCACCACCAGAGGCCACCCGGCTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail