Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|110920
Gene name
Locationscaffold_8:1247895..1251383
Strand+
Gene length (bp)3488
Transcript length (bp)2421
Coding sequence length (bp)2421
Protein length (aa) 807

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07217 Het-C Heterokaryon incompatibility protein Het-C 9.1E-218 13 573

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|110920
MAVPPTTIFLLLFVLFAFCLSGNGVYAFGAGNIPSFAYMEGKAFRHGDIEDVLAEIVKRAAGGLTAVVSKGSKFN
GLDIKRVYFGNWLRDYSQAVDIASLKKIPMQTIINLCMVLGFLAHGYATHEFEVTPERLGCYLPTEHIDNPKGYG
EGEDARRYHPGLRGPVDPRELEIDPRTGMKNYIANENGSWDTSKALVRRTLERCIHLGRLHRSQSRKQDEYEAYR
LLGQLMHTLEDFPAHSNFCELALVSMGHQHVFVHVGDNVRIQAPNGKWVAPIVTGTFGSNDFIHSLLGEATDHLS
EASVTDLNRELDHARSKSIESTARSGPGGGNDVASTLRGMFTSLPGGAGGDLSRDMDSIERIRAGPAAGGKRPED
MSPQELHAVLWQVLTFRDSVVKKISKTIEKIPGLGPLIEKIQDGISVFVFTTLEPFLKPILKTATTSLSAASGEI
IDTHDQYEVFNDPRASDPTHSFLSKDHFNLILNEPAGRVGRVIVQHTVGLVVKAWDNNSENVHAITEDILQCLFH
PDFHNSNSKIQRAMLQTVNEWVQGLGKKQRSVLSRLDKNSVREHQNVRAAGEGGAAPAQGSYAQTQGVGVQHTIA
GYAQNIPGAQTVFSATGFGKVKPGQREFPPSSAGGLPPSSYSGASGGYPSHTGPPPTSSYSDAHTHHNPYPPPSE
PRQPPQRAGYAPSYVSPPPQSYNAPPAPPASSFPGFPGSAPVMSAYGTPSYPPASAPPPSFPGEAGGGFGFPSAP
GGPPEPFGGAVGGQPPPPFGFPSVEPLGGSSPYGVPNQPQGHHHPHEHHHQRPPGW*
Coding >AgabiH97|110920
ATGGCCGTGCCTCCCACCACCATCTTCTTGCTGCTCTTTGTTCTCTTTGCCTTCTGCCTCTCCGGCAATGGCGTC
TATGCCTTTGGCGCCGGAAACATCCCCTCGTTCGCTTACATGGAGGGCAAAGCCTTCCGCCACGGCGATATCGAA
GATGTCCTTGCCGAGATCGTCAAGCGCGCAGCGGGCGGCCTCACGGCAGTGGTCAGCAAGGGATCCAAATTTAAC
GGTCTTGATATCAAGCGCGTCTACTTTGGGAACTGGCTTCGCGATTACAGTCAGGCTGTCGACATAGCGTCACTC
AAAAAGATTCCTATGCAGACAATCATCAACCTGTGCATGGTCCTTGGCTTCCTTGCTCACGGTTATGCGACTCAC
GAGTTCGAAGTGACCCCCGAGCGATTGGGTTGCTATCTTCCGACTGAGCACATTGACAACCCAAAGGGCTACGGT
GAAGGTGAAGATGCGAGGAGATACCATCCAGGCCTCCGAGGCCCCGTCGACCCGCGCGAGCTTGAAATCGATCCT
CGCACTGGTATGAAGAATTACATTGCTAATGAAAATGGTTCTTGGGATACTTCCAAAGCCCTTGTTCGACGTACC
CTTGAACGCTGCATTCATCTCGGTCGCCTTCATCGTTCGCAAAGCAGGAAACAAGATGAATATGAAGCATACAGA
CTTCTCGGTCAGCTTATGCACACTCTAGAAGATTTTCCTGCCCATTCCAATTTTTGCGAGCTGGCTCTCGTTTCT
ATGGGCCATCAGCATGTGTTCGTTCATGTCGGTGACAATGTCAGAATACAAGCTCCGAACGGCAAATGGGTCGCT
CCAATTGTCACTGGAACTTTTGGATCGAATGATTTCATTCATTCACTCCTTGGAGAGGCCACCGACCATCTGAGT
GAAGCGTCAGTGACGGATTTAAACCGTGAACTTGATCACGCCAGATCAAAATCAATCGAGAGCACCGCTCGCTCG
GGCCCTGGAGGTGGTAACGATGTAGCGTCTACCCTTCGCGGCATGTTCACTTCCCTTCCCGGTGGTGCTGGGGGG
GATTTGAGCAGAGACATGGACTCCATCGAAAGGATACGAGCTGGACCAGCTGCTGGTGGGAAAAGGCCAGAAGAT
ATGAGTCCCCAAGAGTTGCACGCCGTACTCTGGCAAGTATTGACATTCAGAGATTCAGTCGTGAAAAAGATTTCG
AAAACAATTGAGAAGATTCCTGGATTAGGACCCTTGATCGAAAAAATACAAGATGGGATATCTGTCTTTGTCTTT
ACGACTCTCGAGCCCTTCCTGAAACCTATATTGAAAACGGCCACCACCAGCTTGTCAGCAGCTTCAGGAGAGATC
ATCGATACCCATGATCAGTATGAAGTTTTTAACGATCCTCGTGCCTCCGATCCGACGCATTCTTTCCTGAGCAAA
GATCATTTTAATTTAATTCTAAATGAACCCGCTGGTAGAGTCGGCAGAGTAATAGTACAGCACACTGTCGGACTT
GTGGTGAAGGCTTGGGACAATAATTCGGAGAACGTCCACGCAATCACTGAAGACATCCTCCAATGTTTGTTCCAC
CCCGACTTTCACAATTCCAACTCAAAGATCCAACGTGCCATGCTCCAAACAGTGAATGAATGGGTGCAAGGTCTT
GGGAAGAAGCAGCGCAGTGTTTTAAGCCGTCTCGACAAGAATTCGGTGAGAGAACACCAGAATGTTCGCGCTGCA
GGGGAAGGTGGTGCGGCCCCCGCACAGGGCTCGTATGCACAGACCCAAGGAGTCGGAGTCCAACATACTATTGCT
GGATACGCGCAGAACATTCCCGGAGCGCAGACAGTCTTCAGTGCTACTGGATTTGGCAAGGTGAAACCTGGACAG
AGAGAGTTTCCGCCATCTAGCGCAGGGGGTCTTCCGCCTAGCTCGTATAGTGGTGCATCAGGCGGGTACCCTTCT
CACACAGGTCCTCCGCCAACTTCATCCTATTCGGATGCCCACACGCATCATAATCCGTATCCTCCGCCATCTGAG
CCACGGCAGCCGCCACAGCGCGCTGGATATGCACCTTCCTATGTTTCCCCTCCTCCACAGTCGTACAACGCGCCC
CCTGCGCCTCCCGCGTCTTCATTCCCTGGCTTCCCAGGCTCGGCACCTGTTATGTCTGCGTACGGTACGCCAAGT
TACCCCCCTGCTAGTGCACCACCCCCTTCGTTCCCCGGGGAAGCTGGAGGTGGATTTGGTTTCCCCTCTGCGCCT
GGTGGGCCTCCAGAACCGTTTGGAGGTGCGGTTGGCGGTCAACCACCACCACCTTTTGGTTTCCCGTCGGTTGAA
CCGCTCGGCGGCTCATCACCCTATGGAGTCCCTAACCAACCGCAAGGACATCATCATCCACATGAACATCACCAC
CAGAGGCCACCCGGCTGGTAA
Transcript >AgabiH97|110920
ATGGCCGTGCCTCCCACCACCATCTTCTTGCTGCTCTTTGTTCTCTTTGCCTTCTGCCTCTCCGGCAATGGCGTC
TATGCCTTTGGCGCCGGAAACATCCCCTCGTTCGCTTACATGGAGGGCAAAGCCTTCCGCCACGGCGATATCGAA
GATGTCCTTGCCGAGATCGTCAAGCGCGCAGCGGGCGGCCTCACGGCAGTGGTCAGCAAGGGATCCAAATTTAAC
GGTCTTGATATCAAGCGCGTCTACTTTGGGAACTGGCTTCGCGATTACAGTCAGGCTGTCGACATAGCGTCACTC
AAAAAGATTCCTATGCAGACAATCATCAACCTGTGCATGGTCCTTGGCTTCCTTGCTCACGGTTATGCGACTCAC
GAGTTCGAAGTGACCCCCGAGCGATTGGGTTGCTATCTTCCGACTGAGCACATTGACAACCCAAAGGGCTACGGT
GAAGGTGAAGATGCGAGGAGATACCATCCAGGCCTCCGAGGCCCCGTCGACCCGCGCGAGCTTGAAATCGATCCT
CGCACTGGTATGAAGAATTACATTGCTAATGAAAATGGTTCTTGGGATACTTCCAAAGCCCTTGTTCGACGTACC
CTTGAACGCTGCATTCATCTCGGTCGCCTTCATCGTTCGCAAAGCAGGAAACAAGATGAATATGAAGCATACAGA
CTTCTCGGTCAGCTTATGCACACTCTAGAAGATTTTCCTGCCCATTCCAATTTTTGCGAGCTGGCTCTCGTTTCT
ATGGGCCATCAGCATGTGTTCGTTCATGTCGGTGACAATGTCAGAATACAAGCTCCGAACGGCAAATGGGTCGCT
CCAATTGTCACTGGAACTTTTGGATCGAATGATTTCATTCATTCACTCCTTGGAGAGGCCACCGACCATCTGAGT
GAAGCGTCAGTGACGGATTTAAACCGTGAACTTGATCACGCCAGATCAAAATCAATCGAGAGCACCGCTCGCTCG
GGCCCTGGAGGTGGTAACGATGTAGCGTCTACCCTTCGCGGCATGTTCACTTCCCTTCCCGGTGGTGCTGGGGGG
GATTTGAGCAGAGACATGGACTCCATCGAAAGGATACGAGCTGGACCAGCTGCTGGTGGGAAAAGGCCAGAAGAT
ATGAGTCCCCAAGAGTTGCACGCCGTACTCTGGCAAGTATTGACATTCAGAGATTCAGTCGTGAAAAAGATTTCG
AAAACAATTGAGAAGATTCCTGGATTAGGACCCTTGATCGAAAAAATACAAGATGGGATATCTGTCTTTGTCTTT
ACGACTCTCGAGCCCTTCCTGAAACCTATATTGAAAACGGCCACCACCAGCTTGTCAGCAGCTTCAGGAGAGATC
ATCGATACCCATGATCAGTATGAAGTTTTTAACGATCCTCGTGCCTCCGATCCGACGCATTCTTTCCTGAGCAAA
GATCATTTTAATTTAATTCTAAATGAACCCGCTGGTAGAGTCGGCAGAGTAATAGTACAGCACACTGTCGGACTT
GTGGTGAAGGCTTGGGACAATAATTCGGAGAACGTCCACGCAATCACTGAAGACATCCTCCAATGTTTGTTCCAC
CCCGACTTTCACAATTCCAACTCAAAGATCCAACGTGCCATGCTCCAAACAGTGAATGAATGGGTGCAAGGTCTT
GGGAAGAAGCAGCGCAGTGTTTTAAGCCGTCTCGACAAGAATTCGGTGAGAGAACACCAGAATGTTCGCGCTGCA
GGGGAAGGTGGTGCGGCCCCCGCACAGGGCTCGTATGCACAGACCCAAGGAGTCGGAGTCCAACATACTATTGCT
GGATACGCGCAGAACATTCCCGGAGCGCAGACAGTCTTCAGTGCTACTGGATTTGGCAAGGTGAAACCTGGACAG
AGAGAGTTTCCGCCATCTAGCGCAGGGGGTCTTCCGCCTAGCTCGTATAGTGGTGCATCAGGCGGGTACCCTTCT
CACACAGGTCCTCCGCCAACTTCATCCTATTCGGATGCCCACACGCATCATAATCCGTATCCTCCGCCATCTGAG
CCACGGCAGCCGCCACAGCGCGCTGGATATGCACCTTCCTATGTTTCCCCTCCTCCACAGTCGTACAACGCGCCC
CCTGCGCCTCCCGCGTCTTCATTCCCTGGCTTCCCAGGCTCGGCACCTGTTATGTCTGCGTACGGTACGCCAAGT
TACCCCCCTGCTAGTGCACCACCCCCTTCGTTCCCCGGGGAAGCTGGAGGTGGATTTGGTTTCCCCTCTGCGCCT
GGTGGGCCTCCAGAACCGTTTGGAGGTGCGGTTGGCGGTCAACCACCACCACCTTTTGGTTTCCCGTCGGTTGAA
CCGCTCGGCGGCTCATCACCCTATGGAGTCCCTAACCAACCGCAAGGACATCATCATCCACATGAACATCACCAC
CAGAGGCCACCCGGCTGGTAA
Gene >AgabiH97|110920
ATGGCCGTGCCTCCCACCACCATCTTCTTGCTGCTCTTTGTTCTCTTTGCCTTCTGCCTCTCCGGCAATGGCGTC
TATGCCTTTGGCGCCGGAAACATCCCCTCGTAAGCCTCCTCCTCACCTCGTGCGCCAAGAAATGATCTCATTACG
CCCCAGGTTCGCTTACATGGAGGGCAAAGCCTTCCGCCACGGCGATATCGTCAGTCCCAACAACAACTGGGTCTC
TCATTAGTTAATAACTCGTAATCTAGGAAGATGTCCTTGCCGAGATCGTCAAGCGCGCAGCGGGCGGCCTCACGG
CAGTGGTCAGCAAGGGATCCAAATTTAACGGTCTTGATATCAAGCGCGTCTACTTTGGGTGCGATCTCTCCTCTT
TAACCTTGACTGTATCTTATCTTCTCGATCGCTCTTTACCTTCAGGAACTGGCTTCGCGATTACAGTCAGGTGAG
CCATCTATGCAGATGTCATTTACGTCACAGATCACTTATTGTATGCGCAGGCTGTCGACATAGCGTCACTCAAAA
AGATTCCTATGCAGGTCTGTTCCCCTCGTTATATCTTCTTTGCGCTGTTTGTTGACTTTCAGTCAGACAATCATC
AACCTGTGCATGGTCCTTGGCTTCCTTGTACGCCCGCAACAGTATTCTCTTGACTCTCATCTGACTAGCTCAGGC
TCACGGTTATGCGACTCACGAGTTCGAAGTGACCCCCGAGCGATTGGGTTGCTATCTTCCGGTGCGCCTGTTGAC
ACTTATCTGCGTTTCCATGCTCAATACCACACAGACTGAGCACATTGACAACCCAAAGGGCTACGGTGAAGGTGA
AGATGCGAGGAGATACCATCCAGGCCTCCGAGGCCCCGTCGACGTGCGTCGCCTCGAGTATATGCATGACAGTTC
TGTACTTAACCTCTTGTACAGCCGCGCGAGCTTGAAATCGATCCTCGCACTGGTATGAAGAATTACATTGCTAAT
GGTATCTTGATGTTCTCGCGTTTCCTGCAACTTTGATTCACGTCATTGCAGAAAATGGTTCTTGGGATACTTCCA
AAGCCCTTGTTCGACGTACCCTTGAACGCTGCATTCATCTCGGTCGCCTTCATCGTTCGCAAAGCAGGAAACAAG
ATGAATATGAAGCATACAGACTTCTCGGTCAGCTTGTGACTACTCTTCACCCTACAGCTGCTCGTGCGTATGCTC
ACGTCGACATTCACCTAGATGCACACTCTAGAAGATTTTCCTGCCCATTCCAATTTTTGCGAGCTGGCTCTCGTT
TCTATGGGCCATCAGCATGTGTTCGTTCATGTCGGTGACAATGTCAGAATACAAGCTCCGAACGGCAAATGGGTC
GCTCCAATTGTCACTGGTCTGCCTGTCTTCGACCTTGTATTTGAGGCATCCTAAACTTCATCACAGGAACTTTTG
GATCGAATGATTTCATTCATTCACTCCTTGGAGGTGCGTGCGTCTTTTTGTGTCCGAGTGCATAACTTTATTAAA
CGTGGAACAGAGGCCACCGACCATCTGGTAAGTTTCTAGCACCAAATCCACACTTTTCCACTTAAGCCTCGTGGG
ACTAATGTTGATTATAGAGTGAAGTAAGTCATTGACATTTATGATCCATAACTGGCCTCATTCCTTACTCCTCAG
GCGTCAGTGACGGATTTAAACCGTGAACTTGATCACGCCAGATCAAAATCAATCGAGAGCACCGCTCGCTCGGGC
CCTGGAGGTGGTAACGATGTAGCGTCTACCCTTCGCGGCATGTTCACTTCCCTTCCCGGTGGTGCTGGGGGGGAT
TTGAGCAGAGACATGGACTCCATCGAAAGGATACGAGCTGGACCAGCTGCTGGTGGGAAAAGGCCAGAAGATATG
AGTCCCCAAGAGTTGCACGCCGTACTCTGGCAAGTATTGACATTCAGAGATTCAGGTAGGCATTCGACGACGTGA
AATAGGCAAAAAAAACTCACGAAAAGTTTTTTAGTCGTGAAAAAGATTTCGAAAACAATTGAGAAGATTCCTGGA
TTAGGACCCTTGATCGAAAAAATACAAGATGGGATATCTGGTGGGTCGCTCTATCATTTATTCCTGAACCTAGTT
CGAATGATCTTTCAGTCTTTGTCTTTACGACTCTCGAGGTATGGCAATCACCGATCACCAATTTATTAGCTCTGA
TTCCGAAATTCAGCCCTTCCTGAAACCTATATTGAAAACGGCCACCACCAGCTTGTCAGCAGCTTCAGGAGAGAT
CATCGATACCCATGATCAGTATGAAGTTTTTAACGATCCTCGTGCCGTACGTTGTGCATATTTTTGAGATGTTAT
CAAACTCACAATCAGCGTAGTCCGATCCGACGCATTCTTTCCTGAGCAAAGATCATTTTGTCAGTTCAATTTTTG
CATGCCACCGAATAGGGCTGACAGTGGCATAGAATTTAATTCTAAATGAACCCGCTGGTAGAGTCGGCAGAGTAA
TAGTACAGCACACTGTCGGACTTGTGGTGAAGGCTTGGGACAATAATTCGGAGAACGTCCACGCAATCACTGAAG
ACATCCTCCAATGTTTGTATGTAGTATTGCCTATTGCCGATGGCTACGAGAGTCCTTGCCTGACGTCATTTTTGC
ATTATTCAAGGTTCCACCCCGACTTTCACAATTCCAACTCAAAGATCCAACGTGCCATGCTCCAAACAGTGAATG
AATGGGTGCAAGGTCTTGGGAAGAAGCAGCGCAGTGTTTTAAGCCGTCTCGACAAGAATTCGGTGAGAGAACACC
AGAATGTTCGCGCTGCAGGGGAAGGTGGTGCGGCCCCCGCACAGGGCTCGTATGCACAGACCCAAGGAGTCGGAG
TCCAACATACTATTGCTGGATACGCGCAGAACATTCCCGGAGCGCAGACAGTCTTCAGTGCTACTGGATTTGGCA
AGGTGAAACCTGGACAGAGAGAGTTTCCGCCATCTAGCGCAGGGGGTCTTCCGCCTAGCTCGTATAGTGGTGCAT
CAGGCGGGTACCCTTCTCACACAGGTCCTCCGCCAACTTCATCCTATTCGGATGCCCACACGCATCATAATCCGT
ATCCTCCGCCATCTGAGCCACGGCAGCCGCCACAGCGCGCTGGATATGCACCTTCCTATGTTTCCCCTCCTCCAC
AGTCGTACAACGCGCCCCCTGCGCCTCCCGCGTCTTCATTCCCTGGCTTCCCAGGCTCGGCACCTGTTATGTCTG
CGTACGGTACGCCAAGTTACCCCCCTGCTAGTGCACCACCCCCTTCGTTCCCCGGGGAAGCTGGAGGTGGATTTG
GTTTCCCCTCTGCGCCTGGTGGGCCTCCAGAACCGTTTGGAGGTGCGGTTGGCGGTCAACCACCACCACCTTTTG
GTTTCCCGTCGGTTGAACCGCTCGGCGGCTCATCACCCTATGGAGTCCCTAACCAACCGCAAGGACATCATCATC
CACATGAACATCACCACCAGAGGCCACCCGGCTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail