Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|110870
Gene name
Locationscaffold_8:1236090..1236686
Strand+
Gene length (bp)596
Transcript length (bp)303
Coding sequence length (bp)303
Protein length (aa) 101

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|110870
MLKKTLLFLALSSVAFVSATPVAQAVEPPLTCPPVAGFLATLAQLQICGYTLPDGSKFRCMCSDPKYKCCYLTPN
AKAGVCIFATACLDFPPLSSPSPSK*
Coding >AgabiH97|110870
ATGCTCAAGAAAACCCTGTTATTCCTCGCTTTATCCTCTGTTGCTTTCGTCTCTGCTACTCCTGTAGCTCAAGCA
GTCGAGCCTCCACTGACCTGTCCTCCTGTGGCCGGATTCCTTGCTACGCTGGCTCAACTTCAAATTTGTGGGTAT
ACGTTGCCTGATGGGAGCAAGTTCCGTTGCATGTGCTCCGACCCGAAGTACAAGTGCTGCTATCTCACCCCCAAT
GCCAAAGCGGGCGTCTGTATATTTGCCACTGCATGCCTTGACTTCCCACCCCTTTCTTCGCCTTCTCCTTCCAAG
TAA
Transcript >AgabiH97|110870
ATGCTCAAGAAAACCCTGTTATTCCTCGCTTTATCCTCTGTTGCTTTCGTCTCTGCTACTCCTGTAGCTCAAGCA
GTCGAGCCTCCACTGACCTGTCCTCCTGTGGCCGGATTCCTTGCTACGCTGGCTCAACTTCAAATTTGTGGGTAT
ACGTTGCCTGATGGGAGCAAGTTCCGTTGCATGTGCTCCGACCCGAAGTACAAGTGCTGCTATCTCACCCCCAAT
GCCAAAGCGGGCGTCTGTATATTTGCCACTGCATGCCTTGACTTCCCACCCCTTTCTTCGCCTTCTCCTTCCAAG
TAA
Gene >AgabiH97|110870
ATGCTCAAGAAAACCCTGTTATTCCTCGCTTTATCCTCTGTTGCTTTCGTCTCTGCTACTCCTGTAGCTCAAGCA
GTCGAGCCTCCACTGACCTGTCCTCCTGTGGCCGGATTCCTTGCTACGCTGGCTCAACTTCAAATTTGTATGTCC
CCCTGTGTCTCCTCTTTATAAATCGGCTATACTGCTAACCAACCTCTTCCCTACTACTTACAATTAGGTGGGTAT
ACGTTGCCTGATGGGAGCAAGGTAAAAGTCTTTATATTACTTGACACCTAATTTGCCTTGCCTTTCTTTTTCTTT
TCGCATTCTGACATTCACCTGCCCTTTTGCGCCGAATATAGTTCCGTTGCATGTGTAAGTTTGAGAGAATTAACA
CTAAGGCTCCAAAGCAGAACGTACTGAATAATGACTATAGGCTCCGACCCGAAGTACAAGTGCTGCTATCTCACC
CCCAATGCCAAAGCGGGCGTGTAAGAATTACAGCTTAAAAAAGTAGATGACGGATGCTCATTTCATTTTTTTTTT
CGTCCAGCTGTATATTTGCCACTGCATGCCTTGACTTCCCACCCCTTTCTTCGCCTTCTCCTTCCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail