Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|110850
Gene name
Locationscaffold_8:1231620..1233313
Strand+
Gene length (bp)1693
Transcript length (bp)1350
Coding sequence length (bp)1350
Protein length (aa) 450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.2E-03 44 66
PF12874 zf-met Zinc-finger of C2H2 type 3.2E-02 12 31

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 13 70 4.0E-07
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 13 70 5.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 3.92 1.52 6.32
Initials Initials knots 2.32 0.85 3.80
Pileal_Stipeal_center Stage I stipe center 3.42 1.42 5.41
Pileal_Stipeal_shell Stage I stipe shell 3.93 1.69 6.18
DIF_stipe_center Stage II stipe center 4.16 1.80 6.51
DIF_stipe_shell Stage II stipe shell 3.44 1.44 5.44
DIF_stipe_skin Stage II stipe skin 3.56 1.50 5.62
DIF_cap_skin Stage II cap skin 3.81 1.62 5.99
DIF_cap_tissue Stage II cap tissue 3.65 1.54 5.76
DIF_gill_tissue Stage II gill tissue 4.21 1.82 6.60
YFB_stipe_center Young fruiting body stipe center 2.90 1.10 4.70
YFB_stipe_shell Young fruiting body stipe shell 2.56 0.99 4.13
YFB_stipe_skin Young fruiting body stipe skin 2.53 0.98 4.08
YFB_cap_skin Young fruiting body cap skin 2.83 1.13 4.53
YFB_cap_tissue Young fruiting body cap tissue 3.99 1.68 6.30
YFB_gill_tissue Young fruiting body gill tissue 3.46 1.41 5.52
YFB_veil Young fruiting body veil 4.42 1.91 6.93

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.924260 no
Casing YFB_stipe_center 0.604756 no
Casing YFB_stipe_shell 0.390497 no
Casing YFB_stipe_skin 0.379450 no
Casing YFB_cap_skin 0.558591 no
Casing YFB_cap_tissue 0.981395 no
Casing YFB_gill_tissue 0.865945 no
Casing YFB_veil 0.865493 no
Casing Initials 0.281732 no
Casing Pileal_Stipeal_center 0.842674 no
Casing Pileal_Stipeal_shell 0.993659 no
Casing DIF_stipe_center 0.939747 no
Casing DIF_stipe_shell 0.851688 no
Casing DIF_stipe_skin 0.897873 no
Casing DIF_cap_skin 0.972443 no
Casing DIF_cap_tissue 0.926632 no
DIF_gill_tissue YFB_stipe_center 0.469902 no
DIF_gill_tissue YFB_stipe_shell 0.266041 no
DIF_gill_tissue YFB_stipe_skin 0.256965 no
DIF_gill_tissue YFB_cap_skin 0.421303 no
DIF_gill_tissue YFB_cap_tissue 0.945158 no
DIF_gill_tissue YFB_gill_tissue 0.751764 no
DIF_gill_tissue YFB_veil 0.952130 no
YFB_stipe_center YFB_stipe_shell 0.867132 no
YFB_stipe_center YFB_stipe_skin 0.851857 no
YFB_stipe_center YFB_cap_skin 0.979027 no
YFB_stipe_center YFB_cap_tissue 0.552071 no
YFB_stipe_center YFB_gill_tissue 0.791656 no
YFB_stipe_center YFB_veil 0.390497 no
YFB_stipe_shell YFB_stipe_skin 0.989412 no
YFB_stipe_shell YFB_cap_skin 0.895720 no
YFB_stipe_shell YFB_cap_tissue 0.334168 no
YFB_stipe_shell YFB_gill_tissue 0.579797 no
YFB_stipe_shell YFB_veil 0.206924 no
YFB_stipe_skin YFB_cap_skin 0.879835 no
YFB_stipe_skin YFB_cap_tissue 0.324600 no
YFB_stipe_skin YFB_gill_tissue 0.562185 no
YFB_stipe_skin YFB_veil 0.202445 no
YFB_cap_skin YFB_cap_tissue 0.504330 no
YFB_cap_skin YFB_gill_tissue 0.749767 no
YFB_cap_skin YFB_veil 0.340893 no
YFB_cap_tissue YFB_gill_tissue 0.833315 no
YFB_cap_tissue YFB_veil 0.885478 no
YFB_gill_tissue YFB_veil 0.678236 no
Initials DIF_gill_tissue 0.181569 no
Initials YFB_stipe_center 0.744180 no
Initials YFB_stipe_shell 0.901429 no
Initials YFB_stipe_skin 0.913413 no
Initials YFB_cap_skin 0.771512 no
Initials YFB_cap_tissue 0.239320 no
Initials YFB_gill_tissue 0.443507 no
Initials YFB_veil 0.141536 no
Initials Pileal_Stipeal_center 0.458640 no
Initials Pileal_Stipeal_shell 0.260599 no
Initials DIF_stipe_center 0.198788 no
Initials DIF_stipe_shell 0.445777 no
Initials DIF_stipe_skin 0.390497 no
Initials DIF_cap_skin 0.301649 no
Initials DIF_cap_tissue 0.356705 no
Pileal_Stipeal_center DIF_gill_tissue 0.721760 no
Pileal_Stipeal_center YFB_stipe_center 0.804474 no
Pileal_Stipeal_center YFB_stipe_shell 0.593554 no
Pileal_Stipeal_center YFB_stipe_skin 0.581500 no
Pileal_Stipeal_center YFB_cap_skin 0.767369 no
Pileal_Stipeal_center YFB_cap_tissue 0.807033 no
Pileal_Stipeal_center YFB_gill_tissue 0.985328 no
Pileal_Stipeal_center YFB_veil 0.637336 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.830601 no
Pileal_Stipeal_center DIF_stipe_center 0.742420 no
Pileal_Stipeal_center DIF_stipe_shell 0.992195 no
Pileal_Stipeal_center DIF_stipe_skin 0.958528 no
Pileal_Stipeal_center DIF_cap_skin 0.876823 no
Pileal_Stipeal_center DIF_cap_tissue 0.928527 no
Pileal_Stipeal_shell DIF_gill_tissue 0.927766 no
Pileal_Stipeal_shell YFB_stipe_center 0.581604 no
Pileal_Stipeal_shell YFB_stipe_shell 0.360018 no
Pileal_Stipeal_shell YFB_stipe_skin 0.348154 no
Pileal_Stipeal_shell YFB_cap_skin 0.534143 no
Pileal_Stipeal_shell YFB_cap_tissue 0.985262 no
Pileal_Stipeal_shell YFB_gill_tissue 0.854207 no
Pileal_Stipeal_shell YFB_veil 0.866769 no
Pileal_Stipeal_shell DIF_stipe_center 0.943734 no
Pileal_Stipeal_shell DIF_stipe_shell 0.839383 no
Pileal_Stipeal_shell DIF_stipe_skin 0.887780 no
Pileal_Stipeal_shell DIF_cap_skin 0.966795 no
Pileal_Stipeal_shell DIF_cap_tissue 0.919104 no
DIF_stipe_center DIF_gill_tissue 0.986413 no
DIF_stipe_center YFB_stipe_center 0.488180 no
DIF_stipe_center YFB_stipe_shell 0.281447 no
DIF_stipe_center YFB_stipe_skin 0.270661 no
DIF_stipe_center YFB_cap_skin 0.439952 no
DIF_stipe_center YFB_cap_tissue 0.957513 no
DIF_stipe_center YFB_gill_tissue 0.772252 no
DIF_stipe_center YFB_veil 0.935292 no
DIF_stipe_center DIF_stipe_shell 0.754028 no
DIF_stipe_center DIF_stipe_skin 0.810780 no
DIF_stipe_center DIF_cap_skin 0.905378 no
DIF_stipe_center DIF_cap_tissue 0.847361 no
DIF_stipe_shell DIF_gill_tissue 0.738791 no
DIF_stipe_shell YFB_stipe_center 0.798884 no
DIF_stipe_shell YFB_stipe_shell 0.583135 no
DIF_stipe_shell YFB_stipe_skin 0.568695 no
DIF_stipe_shell YFB_cap_skin 0.760040 no
DIF_stipe_shell YFB_cap_tissue 0.822078 no
DIF_stipe_shell YFB_gill_tissue 0.992807 no
DIF_stipe_shell YFB_veil 0.654607 no
DIF_stipe_shell DIF_stipe_skin 0.965639 no
DIF_stipe_shell DIF_cap_skin 0.888047 no
DIF_stipe_shell DIF_cap_tissue 0.937378 no
DIF_stipe_skin DIF_gill_tissue 0.790892 no
DIF_stipe_skin YFB_stipe_center 0.747302 no
DIF_stipe_skin YFB_stipe_shell 0.529277 no
DIF_stipe_skin YFB_stipe_skin 0.515837 no
DIF_stipe_skin YFB_cap_skin 0.705834 no
DIF_stipe_skin YFB_cap_tissue 0.868685 no
DIF_stipe_skin YFB_gill_tissue 0.973224 no
DIF_stipe_skin YFB_veil 0.713907 no
DIF_stipe_skin DIF_cap_skin 0.928547 no
DIF_stipe_skin DIF_cap_tissue 0.974219 no
DIF_cap_skin DIF_gill_tissue 0.886951 no
DIF_cap_skin YFB_stipe_center 0.637732 no
DIF_cap_skin YFB_stipe_shell 0.409375 no
DIF_cap_skin YFB_stipe_skin 0.395275 no
DIF_cap_skin YFB_cap_skin 0.588155 no
DIF_cap_skin YFB_cap_tissue 0.952636 no
DIF_cap_skin YFB_gill_tissue 0.897792 no
DIF_cap_skin YFB_veil 0.821957 no
DIF_cap_skin DIF_cap_tissue 0.955908 no
DIF_cap_tissue DIF_gill_tissue 0.828222 no
DIF_cap_tissue YFB_stipe_center 0.704658 no
DIF_cap_tissue YFB_stipe_shell 0.475154 no
DIF_cap_tissue YFB_stipe_skin 0.460175 no
DIF_cap_tissue YFB_cap_skin 0.659480 no
DIF_cap_tissue YFB_cap_tissue 0.902762 no
DIF_cap_tissue YFB_gill_tissue 0.948446 no
DIF_cap_tissue YFB_veil 0.751835 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|110850
MPHTHPYQADCYCYPCDRLFARPSQLQRHLRMTLIHNSGARINRCPQCNKGFTQKSNISEHLRSVHGVIPEDNSG
NRSRGGSATRRRRNGNPLSLGQGKRLAGENARREQVESDGSRTVYLPAVPTRVVPFDKEAPSVGVFSLATLENMH
TEKINGEFKIPDFKEGLGAVDSSTYNSISASSTEAGSPSPYNFITSGPSPFIPSSTIPPPINPIFNLSPEDAEIN
HTENQVKAFFADLEARLKVPGLLAAFPNPSSVNNAQTVVEPSLGEGSTSSWRLPPMSDFFNGSFLAAGPSNYQTR
SVNNAVTEPSLGEGSTSSSRLPPMSDFFNGSFLAAGPSNYQTRQFPPVSSTLLSNWFQAIETQRQENDLKYYEQR
YGANCLLEDAFPSEPLTVHNGTVRPQDIEQQKQQQQQQQPQQLGHYSPLFSDDLNLGLSEYSTDDWYSNYTPTP*
Coding >AgabiH97|110850
ATGCCGCATACACATCCTTACCAGGCCGATTGTTATTGTTATCCTTGTGATAGGCTCTTTGCCCGTCCTAGTCAA
TTGCAACGGCATTTGAGGATGACTCTCATTCACAATAGTGGAGCTAGGATAAATCGTTGTCCTCAGTGTAACAAA
GGTTTCACTCAGAAATCCAACATCTCCGAGCACCTCAGATCTGTCCATGGAGTGATTCCTGAAGACAACTCGGGT
AACAGATCACGTGGTGGATCTGCCACTCGTCGTCGTCGTAATGGAAATCCTTTGAGTCTAGGGCAAGGAAAACGC
CTTGCAGGAGAGAATGCGCGACGCGAACAAGTTGAATCCGATGGTTCTCGAACTGTGTATTTGCCCGCGGTTCCT
ACAAGGGTCGTTCCGTTTGATAAGGAGGCTCCAAGCGTTGGTGTCTTCTCGCTTGCTACATTGGAAAACATGCAT
ACTGAGAAGATCAATGGTGAATTCAAAATACCAGATTTTAAAGAAGGGCTAGGAGCCGTTGATAGTTCTACGTAT
AATTCAATCTCGGCGTCTTCAACCGAAGCTGGTTCTCCATCTCCATACAATTTCATCACCTCCGGCCCTTCTCCA
TTCATCCCCTCTTCAACCATCCCACCACCGATCAATCCCATTTTCAATTTGTCTCCTGAAGATGCCGAGATCAAT
CATACGGAAAATCAAGTCAAGGCTTTTTTCGCAGACCTAGAAGCTCGACTCAAAGTACCTGGTCTATTAGCCGCT
TTCCCAAATCCCTCTTCGGTCAACAATGCTCAGACTGTAGTGGAACCCAGTTTGGGAGAGGGGTCGACTTCGTCA
TGGAGGTTGCCTCCGATGTCCGATTTCTTCAATGGTTCTTTCTTGGCTGCTGGTCCATCGAATTATCAGACTCGT
TCGGTCAACAATGCTGTAACGGAACCCAGTTTGGGAGAGGGGTCGACTTCGTCGTCGAGGTTGCCACCGATGTCC
GATTTCTTCAATGGTTCTTTCTTGGCTGCTGGTCCATCGAATTATCAGACTCGACAATTTCCACCTGTTTCATCG
ACTTTGTTGTCAAACTGGTTTCAGGCGATCGAAACGCAGCGGCAAGAGAACGATCTGAAATACTATGAACAGCGA
TATGGTGCCAATTGTTTGCTAGAGGATGCATTTCCTAGTGAGCCTCTCACTGTCCATAATGGGACGGTGAGACCG
CAGGACATCGAACAGCAGAAGCAGCAGCAACAGCAACAGCAACCACAACAACTAGGTCATTATTCACCGTTGTTT
TCGGATGATTTGAATTTGGGTTTGTCCGAATACTCGACGGATGATTGGTACTCGAATTATACCCCGACCCCCTGA
Transcript >AgabiH97|110850
ATGCCGCATACACATCCTTACCAGGCCGATTGTTATTGTTATCCTTGTGATAGGCTCTTTGCCCGTCCTAGTCAA
TTGCAACGGCATTTGAGGATGACTCTCATTCACAATAGTGGAGCTAGGATAAATCGTTGTCCTCAGTGTAACAAA
GGTTTCACTCAGAAATCCAACATCTCCGAGCACCTCAGATCTGTCCATGGAGTGATTCCTGAAGACAACTCGGGT
AACAGATCACGTGGTGGATCTGCCACTCGTCGTCGTCGTAATGGAAATCCTTTGAGTCTAGGGCAAGGAAAACGC
CTTGCAGGAGAGAATGCGCGACGCGAACAAGTTGAATCCGATGGTTCTCGAACTGTGTATTTGCCCGCGGTTCCT
ACAAGGGTCGTTCCGTTTGATAAGGAGGCTCCAAGCGTTGGTGTCTTCTCGCTTGCTACATTGGAAAACATGCAT
ACTGAGAAGATCAATGGTGAATTCAAAATACCAGATTTTAAAGAAGGGCTAGGAGCCGTTGATAGTTCTACGTAT
AATTCAATCTCGGCGTCTTCAACCGAAGCTGGTTCTCCATCTCCATACAATTTCATCACCTCCGGCCCTTCTCCA
TTCATCCCCTCTTCAACCATCCCACCACCGATCAATCCCATTTTCAATTTGTCTCCTGAAGATGCCGAGATCAAT
CATACGGAAAATCAAGTCAAGGCTTTTTTCGCAGACCTAGAAGCTCGACTCAAAGTACCTGGTCTATTAGCCGCT
TTCCCAAATCCCTCTTCGGTCAACAATGCTCAGACTGTAGTGGAACCCAGTTTGGGAGAGGGGTCGACTTCGTCA
TGGAGGTTGCCTCCGATGTCCGATTTCTTCAATGGTTCTTTCTTGGCTGCTGGTCCATCGAATTATCAGACTCGT
TCGGTCAACAATGCTGTAACGGAACCCAGTTTGGGAGAGGGGTCGACTTCGTCGTCGAGGTTGCCACCGATGTCC
GATTTCTTCAATGGTTCTTTCTTGGCTGCTGGTCCATCGAATTATCAGACTCGACAATTTCCACCTGTTTCATCG
ACTTTGTTGTCAAACTGGTTTCAGGCGATCGAAACGCAGCGGCAAGAGAACGATCTGAAATACTATGAACAGCGA
TATGGTGCCAATTGTTTGCTAGAGGATGCATTTCCTAGTGAGCCTCTCACTGTCCATAATGGGACGGTGAGACCG
CAGGACATCGAACAGCAGAAGCAGCAGCAACAGCAACAGCAACCACAACAACTAGGTCATTATTCACCGTTGTTT
TCGGATGATTTGAATTTGGGTTTGTCCGAATACTCGACGGATGATTGGTACTCGAATTATACCCCGACCCCCTGA
Gene >AgabiH97|110850
ATGCCGCATACACATCCTTACCAGGTACGGACCCCTCGTTGCCACTCGTCCTCATTGTCTTTTTTTTATTGACTT
GATATCCTTTTTAGGCCGATTGTTATTGTTATCCTTGTGATAGGCTCTTTGCCCGTCCTAGTCAATTGCAACGGC
ATTTGAGGATGACTCTCATTCACAATAGTGGAGCTAGGTTAGTGACCTCCGTCACGGTCTTTTTATTGTCTAGTG
ATATTTAACGATTTCCCGCCACCCTCTCTTTTTCAGGATAAATCGTTGTCCTCAGTGTAACAAAGGTTTCACTCA
GAAATCCAACATCTCCGAGCACCTCAGATCTGTGTAAGTCTCTCTCTCTCTCTACTCGTTGAAGATTTTGATACT
GATGCTACTTTGTTGGGGGCGTAATTTAGCCATGGAGTGATTCCTGAAGACAACTCGGGTAACAGATCACGTGGT
GGATCTGCCACTCGTCGTCGTCGTAATGGAAATCCTTTGAGTCTAGGGCAAGGAAAACGCCTTGCAGGAGAGAAT
GCGCGACGCGAACAAGTTGAATCCGATGGTTCTCGAACTGTGTATTTGCCCGCGGTTCCTACAAGGGTCGTTCCG
TTTGATAAGGAGGCTCCAAGCGTTGGTGTGAGTTTATCCTCTTCCACAATTTCTTTTTAGAACTCGCGGTTAATC
AGTCATTGTTTTGTATAGGTCTTCTCGCTTGCTACATTGGAAAACATGCATACTGAGAAGATCAATGGTGAATTC
AAAATACCAGGTTCGTTACCTTTTCTTTCTTTCTTTCTATGAACGATAGAACTGACTAAAGTTTATCTTATCTGT
AGATTTTAAAGAAGGGCTAGGAGCCGTTGATAGTTCTACGTATAATTCAATCTCGGCGTCTTCAACCGAAGCTGG
TTCTCCATCTCCATACAATTTCATCACCTCCGGCCCTTCTCCATTCATCCCCTCTTCAACCATCCCACCACCGAT
CAATCCCATTTTCAATTTGTCTCCTGAAGATGCCGAGATCAATCATACGGAAAATCAAGTCAAGGCTTTTTTCGC
AGACCTAGAAGCTCGACTCAAAGTACCTGGTCTATTAGCCGCTTTCCCAAATCCCTCTTCGGTCAACAATGCTCA
GACTGTAGTGGAACCCAGTTTGGGAGAGGGGTCGACTTCGTCATGGAGGTTGCCTCCGATGTCCGATTTCTTCAA
TGGTTCTTTCTTGGCTGCTGGTCCATCGAATTATCAGACTCGTTCGGTCAACAATGCTGTAACGGAACCCAGTTT
GGGAGAGGGGTCGACTTCGTCGTCGAGGTTGCCACCGATGTCCGATTTCTTCAATGGTTCTTTCTTGGCTGCTGG
TCCATCGAATTATCAGACTCGACAATTTCCACCTGTTTCATCGACTTTGTTGTCAAACTGGTTTCAGGCGATCGA
AACGCAGCGGCAAGAGAACGATCTGAAATACTATGAACAGCGATATGGTGCCAATTGTTTGCTAGAGGATGCATT
TCCTAGTGAGCCTCTCACTGTCCATAATGGGACGGTGAGACCGCAGGACATCGAACAGCAGAAGCAGCAGCAACA
GCAACAGCAACCACAACAACTAGGTCATTATTCACCGTTGTTTTCGGATGATTTGAATTTGGGTTTGTCCGAATA
CTCGACGGATGATTGGTACTCGAATTATACCCCGACCCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail