Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|110810
Gene name
Locationscaffold_8:1218183..1221525
Strand-
Gene length (bp)3342
Transcript length (bp)2529
Coding sequence length (bp)2529
Protein length (aa) 843

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.6E-20 105 330

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 95 286 4.0E-21
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 96 289 1.0E-20
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 95 285 1.0E-19
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 119 275 5.0E-18
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 619 816 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 95 286 4.0E-21
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 96 289 1.0E-20
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 95 285 1.0E-19
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 119 275 5.0E-18
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 619 816 4.0E-10
sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 142 248 2.0E-07
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 142 275 2.0E-07
sp|B4EYY4|MDTG_PROMH Multidrug resistance protein MdtG OS=Proteus mirabilis (strain HI4320) GN=mdtG PE=3 SV=1 103 247 1.0E-06
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 136 277 2.0E-06
sp|D8MQN9|MDTG_ERWBE Multidrug resistance protein MdtG OS=Erwinia billingiae (strain Eb661) GN=mdtG PE=3 SV=1 103 247 3.0E-06
sp|D2BX50|MDTG_DICD5 Multidrug resistance protein MdtG OS=Dickeya dadantii (strain Ech586) GN=mdtG PE=3 SV=1 103 232 6.0E-06
sp|A8GCZ5|MDTG_SERP5 Multidrug resistance protein MdtG OS=Serratia proteamaculans (strain 568) GN=mdtG PE=3 SV=1 103 247 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 100 122 22
2 137 159 22
3 171 190 19
4 195 217 22
5 229 251 22
6 271 293 22
7 672 694 22
8 714 736 22
9 756 778 22
10 819 841 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|110810
MASPGVRQPVRTFGIQDPVNPLPPIDSSSSTESNPVLRILGRVSLGRLRKSSNSSLTRRRDGGTDSISTPTPTPS
TRPPVPTVMQSSGEAFTTPLPVLSMIVLSITMLGEFLSANVSTPFLLFMVKGFGGMPDDSQVAFWAGILVSTFFL
TQFLTSLLWATVAEKHGRRVVLVLSLLGSAVTCSLFGTSTTLQQAIVIRLAQGVFAGAVGVARGSVAFVTDATNE
GRAYAILGFCWGLGGVAGAIIGGSFERPATKWPGAFENVQLFITYPYLLPCVLAALVMLIGAFLGLFLDRDGGPR
EGAIRLLPEKIDIHPPIPEEESTPPSPIFEQSEPRPFIFSLKNRISQRLSTYFASHIPHVQQLTSPIVQPAVPLG
SPQPRHDRSRAFSRTSRVNGSAYGYSNSYRKRLSSNATTATAAQRSSLASSLRRRRGSGVDTGISNEGSDLNFAQ
RLLMANENAVTNIADLWVAAAMNVENEDPFEIEEDEGSPSNGSTESLELGEPLIGMEDVISATPPGRGRRFSRSR
VVQESSPTRRSSHIPSHTRTPIHVPSNLTSPQRRSTSRAFTTHHPSVFGLHSARRLSSAVPSIFSHSGVKTPPAF
LEAQRLVSTFDETLAASGEGAQIDVEAVEEKQPSLTSQLPILVIVQYGMMALHTTTHDQIFMSYLVTDYASGGLN
LTAGHFAQLIALMCLAQIAYQFYLYPNLGPPRGRFSHLAMFRVGSLLFIPSYLSVVLYRAFASSSHDGGNFILMT
ALALSTALRYCGSTFAYTAISILLNYMTPPSAVGYANGIAQSIVSLARCLGPSLGGYVWAVSIHDGPSGYYIGFI
ACAAFCGLSVLQSFLIR*
Coding >AgabiH97|110810
ATGGCCAGCCCTGGCGTCCGGCAGCCCGTGCGCACCTTCGGCATACAAGATCCCGTCAACCCATTACCACCCATC
GACTCCTCGAGCTCCACCGAGTCCAACCCTGTTCTTCGTATACTCGGACGAGTCTCCCTCGGCCGTCTACGCAAG
TCGTCAAATTCGTCATTAACGCGCCGTAGAGATGGCGGGACAGATAGTATCTCAACTCCAACGCCGACCCCAAGT
ACGAGACCTCCCGTTCCGACGGTTATGCAGTCATCTGGGGAAGCATTCACCACACCGCTCCCCGTTCTGTCTATG
ATTGTGCTCTCAATTACTATGCTTGGCGAATTTCTTTCGGCTAACGTCTCCACACCTTTTCTGCTTTTCATGGTA
AAAGGGTTTGGTGGGATGCCTGACGACTCGCAGGTAGCATTCTGGGCGGGAATTCTTGTCTCGACGTTCTTTCTC
ACTCAGTTTCTCACTTCTCTGCTATGGGCTACAGTCGCGGAAAAGCACGGTCGACGTGTGGTGCTCGTCTTGTCA
TTATTAGGTAGTGCCGTCACCTGTTCCCTTTTTGGCACGTCGACGACATTACAACAAGCTATTGTAATCCGACTT
GCACAAGGTGTTTTTGCTGGAGCGGTTGGTGTAGCGCGTGGTTCAGTTGCATTTGTCACTGATGCAACCAACGAA
GGAAGAGCGTATGCCATCCTCGGGTTTTGTTGGGGTTTAGGCGGTGTGGCTGGAGCTATAATTGGTGGCTCGTTC
GAGCGACCTGCAACCAAGTGGCCCGGAGCCTTCGAAAACGTACAACTTTTCATAACATATCCATATCTCCTGCCT
TGTGTTCTGGCAGCACTCGTAATGCTCATAGGCGCCTTTCTTGGACTTTTCTTGGATCGAGATGGGGGACCCAGA
GAAGGGGCCATACGTCTTCTTCCGGAGAAGATTGATATCCACCCACCTATACCTGAAGAAGAATCGACGCCACCA
AGCCCGATATTCGAACAATCAGAGCCGCGGCCTTTCATTTTCTCGCTGAAGAATAGAATTTCTCAGAGACTCTCC
ACTTATTTCGCCTCGCATATTCCTCATGTTCAACAATTGACCTCGCCTATCGTTCAACCTGCTGTTCCCTTGGGA
TCACCGCAACCACGGCACGACAGGTCGCGTGCCTTCTCCCGAACAAGCCGTGTAAATGGGTCTGCATACGGCTAC
AGCAATAGCTATCGCAAAAGGCTGTCCAGTAATGCCACTACTGCAACAGCCGCACAGAGAAGTAGTCTCGCCAGC
TCCCTTCGCCGGAGAAGGGGCAGTGGAGTCGATACTGGGATCAGCAACGAGGGCTCTGATCTTAATTTTGCCCAA
CGCCTATTGATGGCTAATGAGAATGCGGTGACGAACATAGCTGATCTCTGGGTTGCTGCGGCCATGAATGTCGAA
AATGAGGATCCTTTTGAAATAGAGGAAGACGAAGGTTCTCCGTCGAATGGTTCCACGGAGTCTCTCGAACTTGGG
GAACCACTAATTGGCATGGAAGATGTGATTTCGGCAACACCTCCGGGTCGTGGTCGTCGTTTCTCGCGTTCCCGC
GTTGTGCAGGAGTCATCACCGACAAGGCGATCTTCACATATTCCTAGTCATACTCGGACCCCAATTCATGTGCCC
TCCAACCTGACCTCCCCACAGCGCCGGTCTACTTCACGGGCATTCACAACCCACCACCCCTCAGTTTTCGGCTTA
CACTCCGCGCGCCGTCTATCGAGCGCTGTTCCTAGCATATTCTCTCATTCTGGCGTCAAAACTCCTCCCGCCTTC
CTCGAGGCTCAGCGTCTTGTATCTACTTTCGACGAAACTCTGGCTGCTTCGGGAGAAGGCGCACAAATCGATGTG
GAAGCTGTAGAAGAAAAACAACCATCTCTAACCTCTCAGTTGCCCATTCTTGTTATTGTGCAGTATGGGATGATG
GCCCTTCATACTACCACGCATGATCAAATATTCATGTCTTACCTTGTCACGGATTATGCGTCGGGGGGCCTAAAC
CTAACTGCCGGGCATTTCGCACAACTTATCGCCCTGATGTGCCTTGCCCAGATTGCCTATCAATTTTATCTTTAT
CCTAATCTTGGACCCCCTCGTGGCCGTTTCTCTCATCTTGCCATGTTCCGTGTTGGATCACTTCTGTTCATTCCA
TCATACCTTTCCGTTGTTCTATACCGTGCCTTCGCAAGTTCTTCCCATGACGGTGGAAATTTTATCCTTATGACG
GCATTGGCTCTCAGCACCGCGCTCCGTTACTGCGGATCCACTTTTGCTTATACGGCTATCTCGATTCTCTTGAAT
TATATGACACCTCCGAGTGCAGTGGGATATGCAAATGGAATAGCTCAGAGTATTGTTAGTCTGGCACGATGCCTA
GGACCGAGTCTAGGTGGCTATGTTTGGGCAGTGAGTATTCATGATGGACCGAGCGGATATTATATTGGGTTCATT
GCATGTGCCGCGTTTTGCGGTCTTTCTGTGCTTCAAAGCTTCTTGATCCGCTAA
Transcript >AgabiH97|110810
ATGGCCAGCCCTGGCGTCCGGCAGCCCGTGCGCACCTTCGGCATACAAGATCCCGTCAACCCATTACCACCCATC
GACTCCTCGAGCTCCACCGAGTCCAACCCTGTTCTTCGTATACTCGGACGAGTCTCCCTCGGCCGTCTACGCAAG
TCGTCAAATTCGTCATTAACGCGCCGTAGAGATGGCGGGACAGATAGTATCTCAACTCCAACGCCGACCCCAAGT
ACGAGACCTCCCGTTCCGACGGTTATGCAGTCATCTGGGGAAGCATTCACCACACCGCTCCCCGTTCTGTCTATG
ATTGTGCTCTCAATTACTATGCTTGGCGAATTTCTTTCGGCTAACGTCTCCACACCTTTTCTGCTTTTCATGGTA
AAAGGGTTTGGTGGGATGCCTGACGACTCGCAGGTAGCATTCTGGGCGGGAATTCTTGTCTCGACGTTCTTTCTC
ACTCAGTTTCTCACTTCTCTGCTATGGGCTACAGTCGCGGAAAAGCACGGTCGACGTGTGGTGCTCGTCTTGTCA
TTATTAGGTAGTGCCGTCACCTGTTCCCTTTTTGGCACGTCGACGACATTACAACAAGCTATTGTAATCCGACTT
GCACAAGGTGTTTTTGCTGGAGCGGTTGGTGTAGCGCGTGGTTCAGTTGCATTTGTCACTGATGCAACCAACGAA
GGAAGAGCGTATGCCATCCTCGGGTTTTGTTGGGGTTTAGGCGGTGTGGCTGGAGCTATAATTGGTGGCTCGTTC
GAGCGACCTGCAACCAAGTGGCCCGGAGCCTTCGAAAACGTACAACTTTTCATAACATATCCATATCTCCTGCCT
TGTGTTCTGGCAGCACTCGTAATGCTCATAGGCGCCTTTCTTGGACTTTTCTTGGATCGAGATGGGGGACCCAGA
GAAGGGGCCATACGTCTTCTTCCGGAGAAGATTGATATCCACCCACCTATACCTGAAGAAGAATCGACGCCACCA
AGCCCGATATTCGAACAATCAGAGCCGCGGCCTTTCATTTTCTCGCTGAAGAATAGAATTTCTCAGAGACTCTCC
ACTTATTTCGCCTCGCATATTCCTCATGTTCAACAATTGACCTCGCCTATCGTTCAACCTGCTGTTCCCTTGGGA
TCACCGCAACCACGGCACGACAGGTCGCGTGCCTTCTCCCGAACAAGCCGTGTAAATGGGTCTGCATACGGCTAC
AGCAATAGCTATCGCAAAAGGCTGTCCAGTAATGCCACTACTGCAACAGCCGCACAGAGAAGTAGTCTCGCCAGC
TCCCTTCGCCGGAGAAGGGGCAGTGGAGTCGATACTGGGATCAGCAACGAGGGCTCTGATCTTAATTTTGCCCAA
CGCCTATTGATGGCTAATGAGAATGCGGTGACGAACATAGCTGATCTCTGGGTTGCTGCGGCCATGAATGTCGAA
AATGAGGATCCTTTTGAAATAGAGGAAGACGAAGGTTCTCCGTCGAATGGTTCCACGGAGTCTCTCGAACTTGGG
GAACCACTAATTGGCATGGAAGATGTGATTTCGGCAACACCTCCGGGTCGTGGTCGTCGTTTCTCGCGTTCCCGC
GTTGTGCAGGAGTCATCACCGACAAGGCGATCTTCACATATTCCTAGTCATACTCGGACCCCAATTCATGTGCCC
TCCAACCTGACCTCCCCACAGCGCCGGTCTACTTCACGGGCATTCACAACCCACCACCCCTCAGTTTTCGGCTTA
CACTCCGCGCGCCGTCTATCGAGCGCTGTTCCTAGCATATTCTCTCATTCTGGCGTCAAAACTCCTCCCGCCTTC
CTCGAGGCTCAGCGTCTTGTATCTACTTTCGACGAAACTCTGGCTGCTTCGGGAGAAGGCGCACAAATCGATGTG
GAAGCTGTAGAAGAAAAACAACCATCTCTAACCTCTCAGTTGCCCATTCTTGTTATTGTGCAGTATGGGATGATG
GCCCTTCATACTACCACGCATGATCAAATATTCATGTCTTACCTTGTCACGGATTATGCGTCGGGGGGCCTAAAC
CTAACTGCCGGGCATTTCGCACAACTTATCGCCCTGATGTGCCTTGCCCAGATTGCCTATCAATTTTATCTTTAT
CCTAATCTTGGACCCCCTCGTGGCCGTTTCTCTCATCTTGCCATGTTCCGTGTTGGATCACTTCTGTTCATTCCA
TCATACCTTTCCGTTGTTCTATACCGTGCCTTCGCAAGTTCTTCCCATGACGGTGGAAATTTTATCCTTATGACG
GCATTGGCTCTCAGCACCGCGCTCCGTTACTGCGGATCCACTTTTGCTTATACGGCTATCTCGATTCTCTTGAAT
TATATGACACCTCCGAGTGCAGTGGGATATGCAAATGGAATAGCTCAGAGTATTGTTAGTCTGGCACGATGCCTA
GGACCGAGTCTAGGTGGCTATGTTTGGGCAGTGAGTATTCATGATGGACCGAGCGGATATTATATTGGGTTCATT
GCATGTGCCGCGTTTTGCGGTCTTTCTGTGCTTCAAAGCTTCTTGATCCGCTAA
Gene >AgabiH97|110810
ATGGCCAGCCCTGGCGTCCGGCAGCCCGTGCGCACCTTCGGCATACAAGATCCCGTCAACCCATTACCACCCATC
GACTCCTCGAGCTCCACCGAGTCCAACCCTGTTCTTCGTATACTCGGACGAGTCTCCCTCGGCCGTCTACGCAAG
TCGTCAAATTCGTCATTAACGCGCCGTAGAGATGGCGGGACAGATAGTATCTCAACTCCAACGCCGACCCCAAGT
ACGAGACCTCCCGTTCCGACGGTTATGCAGTCATCTGGGGAAGCATTCACCACACCGCTCCCCGTTCTGTCTATG
ATTGTGCTCTCAATTGTATGCATATAATCACCGCTCTTACAATACTACTGGGCTCATCGAATTGTAGACTATGCT
TGGCGAATTTCTTTCGGCTAACGTCTCCACACCTTTTCTGCTTTTCATGGTAAAAGGTACCTTAGGCGCTCGATA
TCCTGGGACTACGCTCACGCCGTAATAGGGTTTGGTGGGATGCCTGACGACTCGCAGGTAGCATTCTGGGCGGGA
ATTCTTGGTAGGAATTCTGCGTTCTTTCCGCACCAACCCCTAAACCTTATTCGTTATCTAGTCTCGACGTTCTTT
CTCACTCAGTTTCTCACTTCTCTGCTATGGGTGAGGGTCTATCATTCGCTTGTGCCTGTATCAATGTGTTTAAGT
CTCCTACGTTTCAGGCTACAGTCGCGGAAAAGCACGGTCGACGTGTGGTGCTCGTCTTGTCATTATTAGGTAGTG
CCGTCACCTGTTCCCTTTTTGGCACGTCGACGACATTACAACAAGCTATTGTAATCCGACTTGCACAAGGTGTTT
TTGCTGGAGCGGTTGGTGTAGCGCGTGGTTCAGTTGCATTTGTCACTGATGCAACCAACGAAGGAAGAGCGTATG
CCATCCTCGGGTCGGTTTTTTTATATAGCTTGAACGCGCTCATCTTAACCTTCATCTTAGGTTTTGTTGGGGTTT
AGGCGGTGTGGCTGGAGCTATAATTGGTGGCTCGTGTATGCTTGTCGTCTTTTCGCGTGTTCTCTCCCCTTTGCT
GACCTTATCTGTATTAGTCGAGCGACCTGCAACCAAGTGGCCCGGAGCCTTCGAAAACGTACAACTTTTCATAAC
ATATCCATATCTCCTGCCTTGTGTTCTGGCAGCACTCGTAATGCTCATAGGTAACTCTTCCAGATCCCGCCTCAT
GACCTACTCAATGATTTGCGCTTAAATTAGGCGCCTTTCTTGGACTTTTCTTGGATCGAGATGGGGGACCCAGAG
AAGGGGCCATACGTCTTCTTCCGGAGAAGATTGATATCCACCCACCTATACCTGAAGAAGAATCGACGCCACCAA
GCCCGATATTCGAACAATCAGAGCCGCGGCCTTTCATTTTCTCGCTGAAGAATAGAATTTCTCAGAGACTCTCCA
CTTATTTCGCCTCGCATATTCCTCATGTTCAACAATTGACCTCGCCTATCGTTCAACCTGCTGTTCCCTTGGGAT
CACCGCAACCACGGCACGACAGGTCGCGTGCCTTCTCCCGAACAAGCCGTGTAAATGGGTCTGCATACGGCTACA
GCAATAGCTATCGCAAAAGGCTGTCCAGTAATGCCACTACTGCAACAGCCGCACAGAGAAGTAGTCTCGCCAGCT
CCCTTCGCCGGAGAAGGGGCAGTGGAGTCGATACTGGGATCAGCAACGAGGGCTCTGATCTTAATTTTGCCCAAC
GCCTATTGATGGCTAATGAGAATGCGGTGACGAACATAGCTGATCTCTGGGTTGCTGCGGCCATGAATGTCGAAA
ATGAGGATCCTTTTGAAATAGAGGAAGACGAAGGTTCTCCGTCGAATGGTTCCACGGAGTCTCTCGAACTTGGGG
AACCACTAATTGGCATGGAAGATGTGATTTCGGCAACACCTCCGGGTCGTGGTCGTCGTTTCTCGCGTTCCCGCG
TTGTGCAGGAGTCATCACCGACAAGGCGATCTTCACATATTCCTAGTCATACTCGGACCCCAATTCATGTGCCCT
CCAACCTGACCTCCCCACAGCGCCGGTCTACTTCACGGGCATTCACAACCCACCACCCCTCAGTTTTCGGCTTAC
ACTCCGCGCGCCGTCTATCGAGCGCTGTTCCTAGCATATTCTCTCATTCTGGCGTCAAAACTCCTCCCGCCTTCC
TCGAGGCTCAGCGTCTTGTATCTACTTTCGACGAAACTCTGGCTGCTTCGGGAGAAGGCGCACAAATCGATGTGG
AAGCTGTAGAAGAAAAACAACCATCTCTAACCTCTCAGTTGCCCATTCTTGTTATTGTGCAGTATGGGATGATGG
CCCTTCATACTACCACGCATGATCAAATATTCATGTCTTACCTTGTCACGTACGTTTTATGGTAACGTTTATCCG
GTCGTGTCCTCATTTAATATAGGGATTATGCGTCGGGGGGCCTAAACCTAACTGCCGGGCATTTCGCACAACTTA
GTACGTTACCTGATCGCTCAAAAAATTGTACTGACCATATGCTCTCCATAGTCGCCCTGATGTGCCTTGCCCAGA
TTGCCTATCAATTTTATCTTTATCCGTGAGTGTACTCCTTGAAAAAAAACTGGAAGGTTACTTACCATGTTTGGC
TCCACAGTAATCTTGGGTGTGTTTATATCCGCGCAGTCATGTTAATTGTCACTGACGAAAAATGAAGACCCCCTC
GTGGCCGTTTCTCTCATCTTGCCATGTTCCGTGTTGGATCACTTCTGTTCATTCCATCATACCTTTCCGTTGTTC
TATACCGTGCCTTCGCAAGTTCTTCCCATGACGGTGGAAATTTTATCCTTATGACGGGTGAGAACGGAATTTTAT
CTGATGGCAATTCTTATTCTGACTGCTCTACGTAGCATTGGCTCTCAGCACGTAAATGAGTGATTAATTGTTTAC
TTGAACCGATCACTAATGGTTTTGCCAATGACACAGCGCGCTCCGTTACTGCGGATCCACTTTTGCTTATACGGC
TATCTCGATTCTCTTGAATTATAGTAGGTTTTCGGGATCGTTGTAGCGATCTCCCTGATTTCTGATTTTTGTGAT
TGCCTCTTCAGTGACACCTCCGAGTGCAGTGGGATATGCAAATGGAATAGCTCAGAGTATTGTTAGTCTGGCACG
ATGCCTAGGACCGAGTCTAGGTGGCTATGTAAGTACTGTTAGTGATCTTTTTGATTATCATCTGCTTAGGATTGT
GTTTATTAGGTTTGGGCAGTGAGTATTCATGATGGACCGAGCGGATATTATATTGGGTTCATTGCATGTGCCGCG
TTTTGCGGTCTTTCTGTGCTTCAAAGCTTCTTGATCCGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail