Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|110670
Gene name
Locationscaffold_8:1173109..1175012
Strand-
Gene length (bp)1903
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 3.0E-40 59 251
PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain 3.6E-20 10 57

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P20654|PP1_EMENI Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimG PE=2 SV=1 7 321 0.0E+00
sp|P13681|PP11_SCHPO Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis2 PE=1 SV=1 5 321 0.0E+00
sp|Q9UW86|PP1_NEUCR Serine/threonine-protein phosphatase PP1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-3 PE=2 SV=1 7 306 0.0E+00
sp|Q5I085|PP1B_XENTR Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus tropicalis GN=ppp1cb PE=2 SV=1 7 321 0.0E+00
sp|Q6GQL2|PP1B_XENLA Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus laevis GN=ppp1cb PE=2 SV=1 7 321 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P20654|PP1_EMENI Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimG PE=2 SV=1 7 321 0.0E+00
sp|P13681|PP11_SCHPO Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis2 PE=1 SV=1 5 321 0.0E+00
sp|Q9UW86|PP1_NEUCR Serine/threonine-protein phosphatase PP1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-3 PE=2 SV=1 7 306 0.0E+00
sp|Q5I085|PP1B_XENTR Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus tropicalis GN=ppp1cb PE=2 SV=1 7 321 0.0E+00
sp|Q6GQL2|PP1B_XENLA Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus laevis GN=ppp1cb PE=2 SV=1 7 321 0.0E+00
sp|P62142|PP1B_RAT Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Rattus norvegicus GN=Ppp1cb PE=1 SV=3 7 321 0.0E+00
sp|P62143|PP1B_RABIT Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CB PE=1 SV=3 7 321 0.0E+00
sp|Q5R740|PP1B_PONAB Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Pongo abelii GN=PPP1CB PE=2 SV=1 7 321 0.0E+00
sp|P61292|PP1B_PIG Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Sus scrofa GN=PPP1CB PE=1 SV=3 7 321 0.0E+00
sp|P62141|PP1B_MOUSE Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Mus musculus GN=Ppp1cb PE=1 SV=3 7 321 0.0E+00
sp|P62140|PP1B_HUMAN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Homo sapiens GN=PPP1CB PE=1 SV=3 7 321 0.0E+00
sp|P62207|PP1B_CHICK Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Gallus gallus GN=PPP1CB PE=1 SV=3 7 321 0.0E+00
sp|Q8MJ47|PP1B_CANLF Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Canis lupus familiaris GN=PPP1CB PE=2 SV=4 7 321 0.0E+00
sp|Q3SWW9|PP1B_BOVIN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Bos taurus GN=PPP1CB PE=2 SV=1 7 321 0.0E+00
sp|P48727|GLC7B_CAEEL Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis elegans GN=gsp-2 PE=2 SV=1 8 321 0.0E+00
sp|Q627N3|GLC7B_CAEBR Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis briggsae GN=gsp-2 PE=3 SV=1 8 321 0.0E+00
sp|Q27497|GLC7A_CAEEL Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis elegans GN=gsp-1 PE=3 SV=2 7 318 0.0E+00
sp|Q61JR3|GLC7A_CAEBR Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis briggsae GN=gsp-1 PE=3 SV=1 7 318 0.0E+00
sp|Q6NVU2|PPIG_XENTR Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Xenopus tropicalis GN=ppp1cc PE=2 SV=1 8 327 0.0E+00
sp|P36874|PP1GA_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A OS=Xenopus laevis GN=ppp1cc-a PE=1 SV=2 8 327 0.0E+00
sp|P62138|PP1A_RAT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus GN=Ppp1ca PE=1 SV=1 5 327 0.0E+00
sp|P62139|PP1A_RABIT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CA PE=1 SV=1 5 327 0.0E+00
sp|P62136|PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens GN=PPP1CA PE=1 SV=1 5 327 0.0E+00
sp|Q3T0E7|PP1A_BOVIN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Bos taurus GN=PPP1CA PE=2 SV=1 5 327 0.0E+00
sp|P63088|PP1G_RAT Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Rattus norvegicus GN=Ppp1cc PE=1 SV=1 8 327 0.0E+00
sp|P63087|PP1G_MOUSE Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Mus musculus GN=Ppp1cc PE=1 SV=1 8 327 0.0E+00
sp|P36873|PP1G_HUMAN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens GN=PPP1CC PE=1 SV=1 8 327 0.0E+00
sp|P61287|PP1G_BOVIN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Bos taurus GN=PPP1CC PE=2 SV=1 8 327 0.0E+00
sp|Q7SZ10|PP1GB_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit B OS=Xenopus laevis GN=ppp1cc-b PE=2 SV=1 8 321 0.0E+00
sp|P62137|PP1A_MOUSE Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus GN=Ppp1ca PE=1 SV=1 5 327 0.0E+00
sp|P32598|PP12_YEAST Serine/threonine-protein phosphatase PP1-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLC7 PE=1 SV=1 5 310 0.0E+00
sp|Q8MJ46|PP1G_CANLF Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Canis lupus familiaris GN=PPP1CC PE=2 SV=1 8 327 0.0E+00
sp|Q8WMS6|PP1A_CANLF Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Canis lupus familiaris GN=PPP1CA PE=2 SV=1 5 327 0.0E+00
sp|P48462|PP1B_DROME Serine/threonine-protein phosphatase beta isoform OS=Drosophila melanogaster GN=flw PE=1 SV=1 7 321 0.0E+00
sp|P48461|PP11_DROME Serine/threonine-protein phosphatase alpha-1 isoform OS=Drosophila melanogaster GN=Pp1alpha-96A PE=1 SV=1 8 321 0.0E+00
sp|P12982|PP12_DROME Serine/threonine-protein phosphatase alpha-2 isoform OS=Drosophila melanogaster GN=Pp1-87B PE=1 SV=1 8 305 0.0E+00
sp|Q05547|PP13_DROME Serine/threonine-protein phosphatase alpha-3 isoform OS=Drosophila melanogaster GN=Pp1-13C PE=1 SV=1 8 305 0.0E+00
sp|P48480|PP11_ACEPE Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Acetabularia peniculus PE=3 SV=1 10 314 0.0E+00
sp|O15757|PP1_DICDI Serine/threonine-protein phosphatase PP1 OS=Dictyostelium discoideum GN=pppB PE=1 SV=1 7 321 0.0E+00
sp|P23880|PP12_SCHPO Serine/threonine-protein phosphatase PP1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds21 PE=3 SV=1 7 318 0.0E+00
sp|P48481|PP12_ACEPE Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Acetabularia peniculus PE=3 SV=1 10 316 0.0E+00
sp|P48489|PP1_ORYSJ Serine/threonine-protein phosphatase PP1 OS=Oryza sativa subsp. japonica GN=Os03g0268000 PE=2 SV=2 10 306 0.0E+00
sp|P48488|PP1_MEDSV Serine/threonine-protein phosphatase PP1 OS=Medicago sativa subsp. varia GN=PP1 PE=2 SV=1 7 324 0.0E+00
sp|P48484|PP14_ARATH Serine/threonine-protein phosphatase PP1 isozyme 4 OS=Arabidopsis thaliana GN=TOPP4 PE=1 SV=1 10 306 0.0E+00
sp|P22198|PP1_MAIZE Serine/threonine-protein phosphatase PP1 OS=Zea mays GN=PP1 PE=2 SV=1 10 302 0.0E+00
sp|P48483|PP13_ARATH Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Arabidopsis thaliana GN=TOPP3 PE=2 SV=1 7 324 0.0E+00
sp|O04858|PP13_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Nicotiana tabacum GN=NPP3 PE=2 SV=1 10 306 1.0E-179
sp|O04857|PP12_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Nicotiana tabacum GN=NPP2 PE=2 SV=1 10 306 6.0E-179
sp|O04856|PP11_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Nicotiana tabacum GN=NPP1 PE=2 SV=1 10 306 2.0E-178
sp|P48482|PP12_ARATH Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Arabidopsis thaliana GN=TOPP2 PE=1 SV=1 10 306 5.0E-178
sp|P48486|PP16_ARATH Serine/threonine-protein phosphatase PP1 isozyme 6 OS=Arabidopsis thaliana GN=TOPP6 PE=1 SV=2 10 327 1.0E-175
sp|P48487|PP1_BRAOL Serine/threonine-protein phosphatase PP1 OS=Brassica oleracea GN=PP1 PE=2 SV=1 10 303 4.0E-175
sp|P30366|PP11_ARATH Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Arabidopsis thaliana GN=TOPP1 PE=2 SV=1 10 306 9.0E-175
sp|O82733|PP17_ARATH Serine/threonine-protein phosphatase PP1 isozyme 7 OS=Arabidopsis thaliana GN=TOPP7 PE=2 SV=3 10 319 3.0E-173
sp|P48485|PP15_ARATH Serine/threonine-protein phosphatase PP1 isozyme 5 OS=Arabidopsis thaliana GN=TOPP5 PE=1 SV=1 10 306 2.0E-172
sp|P48490|PP1_PHAVU Serine/threonine-protein phosphatase PP1 OS=Phaseolus vulgaris PE=2 SV=1 10 325 4.0E-168
sp|Q9M9W3|PP19_ARATH Serine/threonine-protein phosphatase PP1 isozyme 9 OS=Arabidopsis thaliana GN=TOPP9 PE=2 SV=1 10 307 2.0E-164
sp|O82734|PP18_ARATH Serine/threonine-protein phosphatase PP1 isozyme 8 OS=Arabidopsis thaliana GN=TOPP8 PE=2 SV=3 10 307 6.0E-164
sp|P23734|PP12_TRYBB Serine/threonine-protein phosphatase PP1(5.9) OS=Trypanosoma brucei brucei PE=3 SV=2 31 306 3.0E-144
sp|P23733|PP11_TRYBB Serine/threonine-protein phosphatase PP1(4.8) OS=Trypanosoma brucei brucei PE=3 SV=2 31 306 1.0E-142
sp|P78968|PPZ_SCHPO Serine/threonine-protein phosphatase PP-Z OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pzh1 PE=1 SV=1 8 302 2.0E-140
sp|P23777|PP1_BRANA Serine/threonine-protein phosphatase PP1 (Fragment) OS=Brassica napus PE=2 SV=1 64 300 3.0E-139
sp|P26570|PPZ1_YEAST Serine/threonine-protein phosphatase PP-Z1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ1 PE=1 SV=5 8 299 1.0E-136
sp|P33329|PPZ2_YEAST Serine/threonine-protein phosphatase PP-Z2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ2 PE=1 SV=4 3 299 5.0E-136
sp|P11612|PPY_DROME Serine/threonine-protein phosphatase PP-Y OS=Drosophila melanogaster GN=PpY-55A PE=2 SV=2 9 302 4.0E-133
sp|P32945|PPQ1_YEAST Serine/threonine-protein phosphatase PPQ OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPQ1 PE=1 SV=1 8 299 4.0E-129
sp|A0CCD2|PPX4_PARTE Serine/threonine-protein phosphatase PP-X homolog 4 OS=Paramecium tetraurelia GN=Ppx4 PE=3 SV=1 30 320 2.0E-96
sp|A0C1E4|PPX3_PARTE Serine/threonine-protein phosphatase PP-X homolog 3 OS=Paramecium tetraurelia GN=Ppx3 PE=3 SV=1 30 307 2.0E-96
sp|P48463|PP2AA_CHICK Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Gallus gallus GN=PPP2CA PE=2 SV=1 1 303 2.0E-96
sp|P11084|PP4C_RABIT Serine/threonine-protein phosphatase 4 catalytic subunit OS=Oryctolagus cuniculus GN=PPP4C PE=1 SV=2 1 318 2.0E-95
sp|Q0P594|PP2AB_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Bos taurus GN=PPP2CB PE=1 SV=1 9 303 4.0E-95
sp|A9JRC7|PP4CB_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit B OS=Danio rerio GN=ppp4cb PE=2 SV=1 9 318 1.0E-94
sp|Q5R6K8|PP4C_PONAB Serine/threonine-protein phosphatase 4 catalytic subunit OS=Pongo abelii GN=PPP4C PE=2 SV=1 1 318 1.0E-94
sp|P97470|PP4C_MOUSE Serine/threonine-protein phosphatase 4 catalytic subunit OS=Mus musculus GN=Ppp4c PE=1 SV=2 1 318 1.0E-94
sp|P60510|PP4C_HUMAN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Homo sapiens GN=PPP4C PE=1 SV=1 1 318 1.0E-94
sp|A6H772|PP4C_BOVIN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Bos taurus GN=PPP4C PE=1 SV=1 1 318 1.0E-94
sp|P62716|PP2AB_RAT Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp2cb PE=2 SV=1 9 303 1.0E-94
sp|P62715|PP2AB_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Mus musculus GN=Ppp2cb PE=1 SV=1 9 303 1.0E-94
sp|P62714|PP2AB_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Homo sapiens GN=PPP2CB PE=1 SV=1 9 303 1.0E-94
sp|P11611|PP2AB_RABIT Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Oryctolagus cuniculus GN=PPP2CB PE=1 SV=1 9 303 1.0E-94
sp|P48726|PP2A1_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 1 OS=Paramecium tetraurelia GN=Ppn1 PE=3 SV=2 31 303 2.0E-94
sp|Q6BFF6|PP2A3_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 3 OS=Paramecium tetraurelia GN=Ppn3 PE=3 SV=1 31 303 2.0E-94
sp|A0CNL9|PP2A2_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 2 OS=Paramecium tetraurelia GN=Ppn2 PE=3 SV=1 31 303 2.0E-94
sp|P11493|PP2AB_PIG Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (Fragment) OS=Sus scrofa GN=PPP2CB PE=2 SV=2 30 303 2.0E-94
sp|P23696|PP2A_DROME Serine/threonine-protein phosphatase PP2A OS=Drosophila melanogaster GN=mts PE=2 SV=1 1 303 4.0E-94
sp|P63331|PP2AA_RAT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp2ca PE=1 SV=1 9 303 4.0E-94
sp|P67777|PP2AA_RABIT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Oryctolagus cuniculus GN=PPP2CA PE=2 SV=1 9 303 4.0E-94
sp|P67776|PP2AA_PIG Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Sus scrofa GN=PPP2CA PE=2 SV=1 9 303 4.0E-94
sp|P63330|PP2AA_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Mus musculus GN=Ppp2ca PE=1 SV=1 9 303 4.0E-94
sp|P67775|PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens GN=PPP2CA PE=1 SV=1 9 303 4.0E-94
sp|P67774|PP2AA_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Bos taurus GN=PPP2CA PE=1 SV=1 9 303 4.0E-94
sp|Q6P861|PP4C_XENTR Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus tropicalis GN=ppp4c PE=2 SV=1 31 318 6.0E-94
sp|Q6IP91|PP4C_XENLA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus laevis GN=ppp4c PE=2 SV=1 31 318 6.0E-94
sp|P49576|PPX1_PARTE Serine/threonine-protein phosphatase PP-X homolog 1 OS=Paramecium tetraurelia GN=Ppx1 PE=3 SV=2 12 300 7.0E-94
sp|Q5BJ92|PP4C_RAT Serine/threonine-protein phosphatase 4 catalytic subunit OS=Rattus norvegicus GN=Ppp4c PE=2 SV=1 1 318 7.0E-94
sp|P48580|PP2A1_NEUCR Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-1 PE=3 SV=3 3 322 5.0E-93
sp|A0DJ90|PPX2_PARTE Serine/threonine-protein phosphatase PP-X homolog 2 OS=Paramecium tetraurelia GN=Ppx2 PE=3 SV=1 12 300 1.0E-92
sp|A8WGP3|PP4CA_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit A OS=Danio rerio GN=ppp4ca PE=2 SV=1 31 318 2.0E-92
sp|P48528|PPX2_ARATH Serine/threonine-protein phosphatase PP-X isozyme 2 OS=Arabidopsis thaliana GN=PPX2 PE=2 SV=2 9 305 3.0E-92
sp|O76932|PP4C_DROME Serine/threonine-protein phosphatase 4 catalytic subunit OS=Drosophila melanogaster GN=Pp4-19C PE=2 SV=1 31 305 3.0E-92
sp|Q07100|PP2A4_ARATH Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Arabidopsis thaliana GN=PP2A4 PE=2 SV=2 8 303 4.0E-92
sp|A8XE00|PP4C1_CAEBR Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis briggsae GN=pph-4.1 PE=3 SV=1 9 321 5.0E-92
sp|Q9Y0B7|PP4C_DICDI Serine/threonine-protein phosphatase 4 catalytic subunit OS=Dictyostelium discoideum GN=ppp4c PE=1 SV=1 31 305 6.0E-92
sp|Q9XW79|PP4C1_CAEEL Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis elegans GN=pph-4.1 PE=1 SV=1 9 321 9.0E-92
sp|P48577|PP2A_ACEPE Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Acetabularia peniculus PE=2 SV=1 10 303 1.0E-91
sp|Q10BT5|PP2A2_ORYSJ Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A2 PE=2 SV=1 5 303 2.0E-91
sp|A2XN40|PP2A2_ORYSI Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A2 PE=2 SV=2 5 303 2.0E-91
sp|O04860|PP2A5_TOBAC Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Nicotiana tabacum GN=NPP5 PE=2 SV=1 9 303 2.0E-91
sp|Q9XGH7|PP2A_TOBAC Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Nicotiana tabacum PE=2 SV=1 9 303 4.0E-91
sp|Q8X178|PP2A2_BLUGH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Blumeria graminis f. sp. hordei GN=PP2A-2 PE=3 SV=1 2 322 5.0E-91
sp|P0C5D7|PP2A4_ORYSI Putative serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A4 PE=3 SV=1 10 303 5.0E-91
sp|O04951|PP2A5_ARATH Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Arabidopsis thaliana GN=PP2A5 PE=1 SV=1 4 303 1.0E-90
sp|A3C4N5|PP2A4_ORYSJ Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A4 PE=2 SV=2 10 303 1.0E-90
sp|P23635|PP2A1_SCHPO Minor serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa1 PE=3 SV=1 31 305 2.0E-90
sp|Q07098|PP2A2_ARATH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Arabidopsis thaliana GN=PP2A2 PE=1 SV=1 9 303 2.0E-90
sp|Q07099|PP2A1_ARATH Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Arabidopsis thaliana GN=PP2A1 PE=1 SV=1 9 303 2.0E-90
sp|P48578|PP2A3_ARATH Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Arabidopsis thaliana GN=PP2A3 PE=2 SV=1 8 303 3.0E-90
sp|P48529|PPX1_ARATH Serine/threonine-protein phosphatase PP-X isozyme 1 OS=Arabidopsis thaliana GN=PPX1 PE=2 SV=1 31 307 3.0E-90
sp|Q9HFQ2|PP2A1_EMENI Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pphA PE=3 SV=2 2 322 3.0E-90
sp|Q06009|PP2A_MEDSA Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Medicago sativa GN=PP2A PE=2 SV=1 9 303 1.0E-89
sp|P23778|PP2A_BRANA Serine/threonine-protein phosphatase PP2A catalytic subunit (Fragment) OS=Brassica napus PE=2 SV=2 8 303 1.0E-89
sp|Q0E2S4|PP2A3_ORYSJ Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A3 PE=2 SV=1 4 303 5.0E-89
sp|A2X2G3|PP2A3_ORYSI Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A3 PE=2 SV=2 4 303 5.0E-89
sp|P48579|PP2A_HELAN Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Helianthus annuus PE=2 SV=1 9 303 2.0E-88
sp|Q9ZSE4|PP2A_HEVBR Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Hevea brasiliensis GN=PP2A PE=2 SV=1 9 303 6.0E-88
sp|Q9XZE5|PP2AA_DICDI Serine/threonine-protein phosphatase 2A catalytic subunit A OS=Dictyostelium discoideum GN=pho2a PE=1 SV=1 31 303 7.0E-88
sp|P23594|PP2A1_YEAST Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH21 PE=1 SV=1 31 289 9.0E-88
sp|P48458|YT91_CAEEL Putative serine/threonine-protein phosphatase C06A1.3 OS=Caenorhabditis elegans GN=C06A1.3 PE=3 SV=1 34 309 2.0E-87
sp|Q0DBD3|PP2A1_ORYSJ Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A1 PE=2 SV=1 9 303 2.0E-87
sp|A2YEB4|PP2A1_ORYSI Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A1 PE=2 SV=1 9 303 2.0E-87
sp|P23595|PP2A2_YEAST Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH22 PE=1 SV=1 31 300 4.0E-87
sp|Q9XTT8|PP4C2_CAEEL Serine/threonine-protein phosphatase 4 catalytic subunit 2 OS=Caenorhabditis elegans GN=pph-4.2 PE=2 SV=1 33 300 8.0E-87
sp|Q9U9A3|PPP6_DICDI Serine/threonine-protein phosphatase 6 catalytic subunit OS=Dictyostelium discoideum GN=ppp6c PE=2 SV=2 31 307 2.0E-86
sp|P23636|PP2A2_SCHPO Major serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa2 PE=3 SV=1 31 303 3.0E-86
sp|P36614|PPE1_SCHPO Serine/threonine-protein phosphatase ppe1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppe1 PE=1 SV=1 31 306 2.0E-85
sp|Q54RD6|PP2AB_DICDI Probable serine/threonine-protein phosphatase 2A catalytic subunit B OS=Dictyostelium discoideum GN=DDB_G0283187 PE=3 SV=1 31 300 6.0E-85
sp|P48459|YSD1_CAEEL Putative serine/threonine-protein phosphatase C23G10.1 OS=Caenorhabditis elegans GN=C23G10.1 PE=3 SV=2 14 301 6.0E-85
sp|Q8LSN3|FYPP_PEA Phytochrome-associated serine/threonine-protein phosphatase OS=Pisum sativum GN=FYPP PE=1 SV=1 8 305 1.0E-83
sp|Q9SX52|FYPP1_ARATH Phytochrome-associated serine/threonine-protein phosphatase 1 OS=Arabidopsis thaliana GN=FYPP1 PE=2 SV=1 8 305 2.0E-82
sp|Q9LHE7|FYPP3_ARATH Phytochrome-associated serine/threonine-protein phosphatase 3 OS=Arabidopsis thaliana GN=FYPP3 PE=1 SV=1 8 305 4.0E-82
sp|Q10298|YD44_SCHPO Putative serine/threonine-protein phosphatase C22H10.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22H10.04 PE=3 SV=1 8 287 2.0E-81
sp|Q6CNT6|PP4C_KLULA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPH3 PE=3 SV=1 8 322 5.0E-81
sp|P32345|PP4C_YEAST Serine/threonine-protein phosphatase 4 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH3 PE=1 SV=2 8 321 8.0E-81
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 3 321 1.0E-80
sp|O00743|PPP6_HUMAN Serine/threonine-protein phosphatase 6 catalytic subunit OS=Homo sapiens GN=PPP6C PE=1 SV=1 31 284 1.0E-80
sp|Q64620|PPP6_RAT Serine/threonine-protein phosphatase 6 catalytic subunit OS=Rattus norvegicus GN=Ppp6c PE=2 SV=2 31 284 2.0E-80
sp|Q9CQR6|PPP6_MOUSE Serine/threonine-protein phosphatase 6 catalytic subunit OS=Mus musculus GN=Ppp6c PE=1 SV=1 31 284 2.0E-80
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 31 321 4.0E-80
sp|Q09496|PPH6_CAEEL Putative serine/threonine-protein phosphatase pph-6 OS=Caenorhabditis elegans GN=pph-6 PE=3 SV=2 31 287 1.0E-79
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 13 321 1.0E-79
sp|Q6FM81|PP4C_CANGA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPH3 PE=3 SV=1 8 303 2.0E-79
sp|P20604|PP11_YEAST Serine/threonine-protein phosphatase PP1-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT4 PE=1 SV=1 31 300 4.0E-79
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 13 321 5.0E-79
sp|Q74ZR2|PP4C_ASHGO Serine/threonine-protein phosphatase 4 catalytic subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPH3 PE=3 SV=2 30 321 8.0E-78
sp|Q5A6B6|PPG1_CANAL Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PPG1 PE=1 SV=1 6 286 8.0E-78
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 13 321 9.0E-78
sp|Q27884|PPP6_DROME Serine/threonine-protein phosphatase 6 catalytic subunit OS=Drosophila melanogaster GN=PpV PE=2 SV=1 31 287 3.0E-77
sp|Q59KY8|SIT4_CANAL Serine/threonine-protein phosphatase SIT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIT4 PE=1 SV=1 29 301 5.0E-77
sp|O74789|YOU5_SCHPO Putative serine/threonine-protein phosphatase C26H8.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.05c PE=1 SV=1 7 318 4.0E-75
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 31 299 3.0E-74
sp|P32838|PP2A4_YEAST Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPG1 PE=1 SV=2 8 312 4.0E-73
sp|Q12705|PP2B_SCHPO Serine/threonine-protein phosphatase 2B catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppb1 PE=3 SV=2 30 291 2.0E-69
sp|Q7YSW8|PP2BA_DICDI Calcineurin subunit A OS=Dictyostelium discoideum GN=canA PE=1 SV=1 30 291 2.0E-66
sp|Q05681|PP2B_NEUCR Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cna-1 PE=2 SV=2 30 291 2.0E-66
sp|Q9VXF1|PP2B3_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 3 OS=Drosophila melanogaster GN=CanA-14F PE=1 SV=4 30 291 3.0E-66
sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 48 286 4.0E-66
sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 38 284 5.0E-66
sp|Q27889|PP2B2_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 2 OS=Drosophila melanogaster GN=Pp2B-14D PE=1 SV=2 4 291 5.0E-66
sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 48 286 7.0E-66
sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 48 286 8.0E-66
sp|Q08209|PP2BA_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens GN=PPP3CA PE=1 SV=1 27 291 1.0E-65
sp|P48452|PP2BA_BOVIN Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Bos taurus GN=PPP3CA PE=1 SV=1 27 291 1.0E-65
sp|Q4WUR1|PP2B_ASPFU Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cnaA PE=3 SV=2 24 291 1.0E-65
sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 38 284 1.0E-65
sp|P63329|PP2BA_RAT Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp3ca PE=1 SV=1 27 291 2.0E-65
sp|P63328|PP2BA_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Mus musculus GN=Ppp3ca PE=1 SV=1 27 291 2.0E-65
sp|O42773|PP2B1_CRYNH Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNA1 PE=3 SV=1 30 291 5.0E-65
sp|P48454|PP2BC_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Homo sapiens GN=PPP3CC PE=1 SV=3 18 291 7.0E-65
sp|P48457|PP2B_EMENI Serine/threonine-protein phosphatase 2B catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cnaA PE=3 SV=3 30 291 8.0E-65
sp|P20651|PP2BB_RAT Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp3cb PE=1 SV=1 18 291 2.0E-64
sp|P16298|PP2BB_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Homo sapiens GN=PPP3CB PE=1 SV=2 9 291 3.0E-64
sp|P48453|PP2BB_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Mus musculus GN=Ppp3cb PE=1 SV=2 18 291 3.0E-64
sp|P48455|PP2BC_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Mus musculus GN=Ppp3cc PE=1 SV=1 46 291 1.0E-63
sp|P23287|PP2B1_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNA1 PE=1 SV=2 26 291 3.0E-62
sp|P48456|PP2B1_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 1 OS=Drosophila melanogaster GN=CanA1 PE=2 SV=2 30 291 4.0E-61
sp|P14747|PP2B2_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMP2 PE=1 SV=2 24 291 9.0E-61
sp|P48460|YY06_CAEEL Putative serine/threonine-protein phosphatase C27B7.6 OS=Caenorhabditis elegans GN=C27B7.6 PE=3 SV=4 16 299 1.0E-60
sp|P53043|PPT1_YEAST Serine/threonine-protein phosphatase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPT1 PE=1 SV=1 36 286 1.0E-58
sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 44 295 2.0E-57
sp|Q8SRZ0|PP1L_ENCCU Probable serine/threonine-protein phosphatase ECU05_0440 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU05_0440 PE=1 SV=1 55 275 5.0E-56
sp|P34350|YK84_CAEEL Uncharacterized protein C30A5.4 OS=Caenorhabditis elegans GN=C30A5.4 PE=4 SV=1 35 290 2.0E-43
sp|Q3SWT6|PPE1_RAT Serine/threonine-protein phosphatase with EF-hands 1 OS=Rattus norvegicus GN=Ppef1 PE=2 SV=1 31 282 2.0E-40
sp|P40421|RDGC_DROME Serine/threonine-protein phosphatase rdgC OS=Drosophila melanogaster GN=rdgC PE=2 SV=1 10 308 6.0E-40
sp|O35655|PPE1_MOUSE Serine/threonine-protein phosphatase with EF-hands 1 OS=Mus musculus GN=Ppef1 PE=2 SV=2 31 282 2.0E-39
sp|Q9FN02|PPP7_ARATH Serine/threonine-protein phosphatase 7 OS=Arabidopsis thaliana GN=PP7 PE=1 SV=1 54 306 4.0E-35
sp|O14829|PPE1_HUMAN Serine/threonine-protein phosphatase with EF-hands 1 OS=Homo sapiens GN=PPEF1 PE=1 SV=1 31 293 2.0E-34
sp|Q9LNG5|PPP7L_ARATH Serine/threonine-protein phosphatase 7 long form homolog OS=Arabidopsis thaliana GN=At1g48120 PE=2 SV=1 43 305 5.0E-30
sp|O14830|PPE2_HUMAN Serine/threonine-protein phosphatase with EF-hands 2 OS=Homo sapiens GN=PPEF2 PE=1 SV=2 60 189 3.0E-28
sp|O35385|PPE2_MOUSE Serine/threonine-protein phosphatase with EF-hands 2 OS=Mus musculus GN=Ppef2 PE=2 SV=1 60 189 2.0E-27
sp|Q9LEV0|PPP7I_ARATH Serine/threonine-protein phosphatase 7 inactive homolog OS=Arabidopsis thaliana GN=At5g10900 PE=3 SV=1 57 250 6.0E-24
sp|P34430|YL39_CAEEL Uncharacterized protein F44B9.9 OS=Caenorhabditis elegans GN=F44B9.9 PE=4 SV=2 201 298 9.0E-12
sp|O35385|PPE2_MOUSE Serine/threonine-protein phosphatase with EF-hands 2 OS=Mus musculus GN=Ppef2 PE=2 SV=1 177 290 6.0E-11
sp|O14830|PPE2_HUMAN Serine/threonine-protein phosphatase with EF-hands 2 OS=Homo sapiens GN=PPEF2 PE=1 SV=2 202 290 9.0E-11
sp|P34430|YL39_CAEEL Uncharacterized protein F44B9.9 OS=Caenorhabditis elegans GN=F44B9.9 PE=4 SV=2 45 112 3.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|110670
MAEPSPDIDLDSVIDRLLEVRGNRPGKPVQLQEYEIKHLCTKAREIFITQPILLELEAPIKICGDIHGQYYDLLR
LFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLW
KTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDITGWSENDRGVS
FTFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFAKRHLVTLFSAPNYCGEFDNAGAMMSVDETLLCSFQILKPA
EKKPKYPYGGMNMGRPVTPPRFGGVSK*
Coding >AgabiH97|110670
ATGGCAGAACCATCACCAGATATCGACCTTGACTCTGTAATCGACCGTCTGCTAGAAGTACGCGGAAATCGACCT
GGCAAGCCCGTACAGCTCCAGGAGTACGAAATTAAACATCTCTGTACAAAAGCGCGCGAAATCTTCATTACCCAA
CCCATTCTCCTTGAACTCGAGGCCCCCATCAAAATCTGCGGTGACATTCACGGACAGTATTACGACCTTCTCCGA
CTTTTCGAATATGGCGGTTTCCCACCAGAAGCCAACTACCTTTTCCTTGGTGACTACGTCGATAGAGGAAAACAA
TCCTTAGAGACCATTTGTCTCCTCCTTGCCTACAAGATCAAATATCCCGAAAACTTCTTCATCCTACGTGGAAAT
CATGAGTGCGCTAGTATCAATAGGATTTACGGCTTTTATGATGAATGTAAACGCCGATACAACATCAAACTTTGG
AAGACTTTTACGGATTGTTTCAACTGCTTGCCTATCGCAGCCATCATTGACGAAAAGATTTTCACGATGCACGGT
GGTCTTAGTCCTGACCTACAGTCGATGGAGCAGATACGTAGGGTAATGCGCCCGACAGATGTTCCAGATACAGGG
TTACTTTGTGACTTGCTATGGTCCGATCCAGACAAAGACATTACAGGATGGTCAGAAAACGACCGGGGCGTGTCG
TTCACCTTTGGGCCAGATGTTGTATCAAGATTCCTACAGAAACACGATATGGATTTGATCTGTCGAGCGCATCAA
GTTGTCGAGGATGGATACGAATTCTTCGCCAAGAGGCATCTAGTGACTCTCTTTTCTGCCCCGAATTATTGTGGA
GAGTTCGATAATGCAGGTGCGATGATGAGTGTGGATGAGACGTTGCTATGTTCGTTCCAGATCTTGAAACCTGCG
GAGAAAAAACCCAAGTACCCGTATGGAGGAATGAACATGGGGAGGCCTGTGACACCACCTCGTTTTGGGGGCGTA
AGCAAATGA
Transcript >AgabiH97|110670
ATGGCAGAACCATCACCAGATATCGACCTTGACTCTGTAATCGACCGTCTGCTAGAAGTACGCGGAAATCGACCT
GGCAAGCCCGTACAGCTCCAGGAGTACGAAATTAAACATCTCTGTACAAAAGCGCGCGAAATCTTCATTACCCAA
CCCATTCTCCTTGAACTCGAGGCCCCCATCAAAATCTGCGGTGACATTCACGGACAGTATTACGACCTTCTCCGA
CTTTTCGAATATGGCGGTTTCCCACCAGAAGCCAACTACCTTTTCCTTGGTGACTACGTCGATAGAGGAAAACAA
TCCTTAGAGACCATTTGTCTCCTCCTTGCCTACAAGATCAAATATCCCGAAAACTTCTTCATCCTACGTGGAAAT
CATGAGTGCGCTAGTATCAATAGGATTTACGGCTTTTATGATGAATGTAAACGCCGATACAACATCAAACTTTGG
AAGACTTTTACGGATTGTTTCAACTGCTTGCCTATCGCAGCCATCATTGACGAAAAGATTTTCACGATGCACGGT
GGTCTTAGTCCTGACCTACAGTCGATGGAGCAGATACGTAGGGTAATGCGCCCGACAGATGTTCCAGATACAGGG
TTACTTTGTGACTTGCTATGGTCCGATCCAGACAAAGACATTACAGGATGGTCAGAAAACGACCGGGGCGTGTCG
TTCACCTTTGGGCCAGATGTTGTATCAAGATTCCTACAGAAACACGATATGGATTTGATCTGTCGAGCGCATCAA
GTTGTCGAGGATGGATACGAATTCTTCGCCAAGAGGCATCTAGTGACTCTCTTTTCTGCCCCGAATTATTGTGGA
GAGTTCGATAATGCAGGTGCGATGATGAGTGTGGATGAGACGTTGCTATGTTCGTTCCAGATCTTGAAACCTGCG
GAGAAAAAACCCAAGTACCCGTATGGAGGAATGAACATGGGGAGGCCTGTGACACCACCTCGTTTTGGGGGCGTA
AGCAAATGA
Gene >AgabiH97|110670
ATGGCAGAACCATCACCAGATATCGACCTTGACTCTGTAATCGACCGTCTGCTAGAAGGTGAGGCTTTTTTTCCC
CTGAAAATTTCCCCCTGGCGGTCACTCGTGGCAATTTGACGCGTCAAAGAACTACCATCCCCCAATCTGTCCTAC
GCCGCCCATACCCTGGCTACACCATCACAGCCTGACGTAGGGCAAGCAGCGAGCAGCGGGACTGGATTCGTCCTT
GAAACGAGTCGGGGAGAGCTGCTCGGTCCGGAGCTGCTTCGCTAGAGGCATTGCGTTACTGCAACTCTCCCGCCG
CGATCAGTTTTATTTTTCTTGCTCTCGCCTGGCAGTGCTACTACTACTTAATGGTGGCAAGCTTTTCGTTCCGAG
AAAAAATCGTGCCACTGTGGTGTTGCTCTGATCCCCAACCTGACATCAATAACCCTGCTGACTCAACTCTTGACA
ATTTTTTCAAACAGTACGCGGAAATCGACCTGGCAAGCCCGTACAGCTCCAGGAGTACGAAATTAAACATCTCTG
TACAAAAGCGCGCGAAATCTTCATTACCCAACCCATTCTCCTTGAACTCGAGGCCCCCATCAAAATCTGCGGTAC
GTCCCCCGATCCCTGACCCCATTTTTTTCCCTGACCTCGGCCGACTACAGGTGACATTCACGGACAGTATTACGA
CCTTCTCCGACTTTTCGAATATGGCGGTTTCCCACCAGAAGCCAACTACCTTTTCCTTGGTGACTACGTCGATAG
AGGAAAACAATCCTTAGAGACCATTTGTCTCCTCCTTGCCTACAAGATCAAATATCCCGAAAACTTCTTCATCCT
ACGTGGAAATCATGAGTGCGCTAGTATCAATAGGATTTACGGCTTTTATGATGAATGTCTGTCCCTTTTTCTCGT
GCTCTGGCCCGCGCTAAAAATTGCTCATTTTTCTGATGCTTTGCATTCCTGCAGGTAAACGCCGATACAACATCA
AACTTTGGAAGACTTTTACGGATTGTTTCAACTGCTTGCCTATCGCAGCCATCATTGACGAAAAGATTTTCACGA
TGCACGGTGGTCTTAGTCCTGACCTACAGTCGATGGAGCAGATACGTAGGGTAATGCGCCCGACAGATGTTCCAG
ATACAGGTGCGCCTTACATCAAACACGTTTATCCGGCGGGGCTATTATGTTGACTCTGCTTTGTGCGACACGTGT
TCCTCAGGGTTACTTTGTGACTTGCTATGGTCCGATCCAGACAAAGACATTACAGGATGGTCAGAAAACGACCGG
GGCGTGTCGTTCACCTTTGGGCCAGATGTTGTATCAAGATTCCTACAGAAACACGATATGGATTTGATCTGTCGA
GCGCATCAAGTAAGTTTTTGTTCGTTCATTCCGCGGCACTTCCTTGTATATCCGTTTTGTTCTCGAGAGAGACAG
TGATACCCGACCATTGATAGGCTTTTTGTGATTCTTTTTGTGATATCTTAGTCTCGCTGAAAATGCTGGATCTAG
TGACTAATGTCTCCTCCCCTGTTTCTAAAAATAGGTTGTCGAGGATGGATACGAATTCTTCGCCAAGAGGCATCT
AGTGACTCTCTTTTCTGCCCCGAATTATTGTGGAGAGTTCGATAATGCAGGTGCGATGATGAGTGTGGATGAGAC
GTTGCTATGTTCGTTCCAGGTATGTTGTTGGCTCTTGCAGGCGAATAAATTTGACTCACGTACGCTCCTCTTCCT
ATCTTTTCTCCCACCCTGCCCCGTAGATCTTGAAACCTGCGGAGAAAAAACCCAAGTACCCGTATGGAGGAATGA
ACATGGGGAGGCCTGTGACACCACCTCGTAAGCAAAAAAAGAAAGATAGCAAGATGGGCTGAAGCTCATCCACTT
GGGAGGTTTTGGGGGCGTAAGCAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail