Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|110610
Gene name
Locationscaffold_8:1152718..1155492
Strand+
Gene length (bp)2774
Transcript length (bp)1899
Coding sequence length (bp)1899
Protein length (aa) 633

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 4.0E-15 143 410

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase asm-3 OS=Caenorhabditis elegans GN=asm-3 PE=3 SV=2 30 552 6.0E-58
sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus GN=SMPD1 PE=2 SV=1 144 558 9.0E-57
sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus musculus GN=Smpd1 PE=2 SV=2 144 558 3.0E-56
sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorhabditis elegans GN=asm-2 PE=1 SV=3 55 564 2.0E-55
sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens GN=SMPD1 PE=1 SV=4 144 558 4.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase asm-3 OS=Caenorhabditis elegans GN=asm-3 PE=3 SV=2 30 552 6.0E-58
sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus GN=SMPD1 PE=2 SV=1 144 558 9.0E-57
sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus musculus GN=Smpd1 PE=2 SV=2 144 558 3.0E-56
sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorhabditis elegans GN=asm-2 PE=1 SV=3 55 564 2.0E-55
sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens GN=SMPD1 PE=1 SV=4 144 558 4.0E-55
sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorhabditis elegans GN=asm-1 PE=1 SV=2 37 558 6.0E-54
sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyostelium discoideum GN=sgmB PE=3 SV=1 65 579 1.0E-51
sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyostelium discoideum GN=sgmA PE=3 SV=1 62 551 4.0E-48
sp|Q641Z7|ASM3A_RAT Acid sphingomyelinase-like phosphodiesterase 3a OS=Rattus norvegicus GN=Smpdl3a PE=2 SV=1 105 551 1.0E-31
sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesterase 3b OS=Homo sapiens GN=SMPDL3B PE=2 SV=2 135 552 5.0E-31
sp|P70158|ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a OS=Mus musculus GN=Smpdl3a PE=1 SV=2 144 551 9.0E-30
sp|Q92484|ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a OS=Homo sapiens GN=SMPDL3A PE=1 SV=2 125 551 1.0E-29
sp|Q3ZC91|ASM3A_BOVIN Acid sphingomyelinase-like phosphodiesterase 3a OS=Bos taurus GN=SMPDL3A PE=2 SV=1 125 551 8.0E-29
sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dictyostelium discoideum GN=sgmC PE=3 SV=1 147 552 2.0E-27
sp|P58242|ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b OS=Mus musculus GN=Smpdl3b PE=1 SV=1 135 552 9.0E-27
sp|Q55GC7|SGMD_DICDI Sphingomyelinase phosphodiesterase D OS=Dictyostelium discoideum GN=sgmD PE=3 SV=1 144 489 3.0E-21
sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPN1 PE=3 SV=1 108 412 1.0E-13
sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPN1 PE=1 SV=1 144 412 3.0E-11
sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PPN1 PE=3 SV=3 144 412 3.0E-10
sp|Q756F2|PPN1_ASHGO Endopolyphosphatase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPN1 PE=3 SV=2 144 412 2.0E-09
sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPN1 PE=3 SV=1 144 412 4.0E-09
sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PPN1 PE=3 SV=1 194 412 7.0E-09
sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppn1 PE=3 SV=1 144 412 7.0E-08
sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PPN1 PE=3 SV=1 193 518 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|110610
MKTSWLLTLAAAFCCIGGINADLVDDIVNAITHAVDCASCHALLLPLAGLALIGDGALTGTITAVCKALGVEDDD
VCEGVIGDQGPILAHDLRSISPFGRTATLLCEATFGLCQAPAVNQFKFPLPAAPVNPKKWTSSGREPFQVVHFSD
VHIDRDYTPGAEVQCTKPICCRNWADAAGEPIKEAAGPIGSHSCDTSTSLIQSMLHAASIQENSFSIFTGDVIEA
DIWLVNQNGVTSNLKQFDEEMQTIMTNSVFPVMGNHDVAPVNSFPRNTSDGATSSQWAFDVQSSGWSKWLDASAI
DSVQHMSGSYSILVPGRNLRVISMNDIYWYKANFWLFDSDNLQRDPNGILTFVAEQLQAAEDAGQRAWIIAHMPP
NSGDALHDQSNYFDQIVRRYSNTIAGQFYGHTHRDEFGISYSDYDNRIAENAISTSWICPSTTPRSGNPAFKVYD
VDPDTFEVMDARVFFSDVNDASFQTAPQWTQYYSAREVYGAAIPGGWPATTPLTPAFWHKVTEAFERDDNLFKKY
LEFKNRGINVETCAPGACKDQALCQLRAGRSESNCQITTPGLNFRRRDSEESHKHDGRRSTIDHCEGTGLGTILS
QMPGKMAGANIEGLRQKLAEQSIQWEGVKHQT*
Coding >AgabiH97|110610
ATGAAAACCAGCTGGTTGTTAACTCTTGCTGCAGCATTTTGCTGTATCGGAGGAATAAATGCGGACCTGGTCGAT
GATATCGTGAACGCAATAACTCACGCTGTGGATTGCGCTTCATGCCATGCGCTCCTCCTTCCTCTCGCTGGACTA
GCTCTGATCGGAGACGGCGCACTCACTGGAACCATTACTGCTGTCTGTAAGGCTCTCGGGGTCGAAGACGACGAT
GTCTGTGAAGGCGTGATTGGTGACCAAGGCCCTATTCTGGCTCATGATCTACGTTCCATCTCGCCTTTCGGACGA
ACTGCAACTCTATTGTGTGAAGCTACTTTCGGTCTTTGTCAGGCTCCTGCCGTCAATCAGTTCAAATTTCCGCTC
CCAGCTGCCCCGGTTAATCCGAAGAAATGGACTAGCAGTGGTCGCGAACCATTTCAAGTTGTTCACTTCAGTGAT
GTTCACATAGATCGGGATTACACGCCCGGTGCGGAAGTACAGTGCACGAAACCAATTTGTTGTAGAAATTGGGCG
GATGCGGCTGGAGAGCCAATCAAAGAGGCCGCGGGACCAATAGGAAGTCATAGCTGTGATACCTCGACAAGCCTC
ATTCAGAGCATGCTCCATGCTGCTTCGATTCAAGAGAATTCCTTCTCGATTTTCACAGGTGACGTTATCGAAGCT
GATATTTGGTTGGTGAACCAGAATGGGGTTACGAGTAATTTGAAACAGTTTGACGAGGAAATGCAGACAATCATG
ACGAATTCGGTCTTTCCTGTCATGGGAAATCATGATGTAGCTCCCGTCAATTCGTTCCCTCGTAATACAAGCGAC
GGGGCCACCTCTTCTCAATGGGCTTTTGATGTTCAATCTTCGGGTTGGTCGAAATGGCTCGATGCTTCCGCCATA
GATTCTGTTCAACATATGTCTGGGAGTTATTCAATCCTTGTACCGGGAAGAAATCTTCGCGTCATTTCAATGAAC
GATATTTATTGGTACAAAGCGAATTTCTGGCTCTTTGATAGCGACAACCTCCAACGAGATCCCAATGGTATCCTG
ACCTTTGTTGCGGAGCAACTCCAAGCTGCGGAGGATGCTGGTCAGAGGGCGTGGATCATCGCACACATGCCCCCG
AACAGTGGTGATGCACTCCATGACCAGTCGAACTACTTTGATCAGATTGTCCGGCGATACAGCAATACTATAGCA
GGTCAATTCTATGGTCATACACATCGGGATGAATTCGGTATCTCGTACTCGGATTATGATAATCGCATAGCAGAA
AATGCTATCAGTACTTCATGGATTTGTCCTTCAACAACCCCGCGATCCGGAAACCCTGCATTCAAAGTTTACGAC
GTCGATCCAGATACTTTTGAAGTCATGGACGCAAGGGTATTTTTCAGTGATGTGAATGACGCATCCTTCCAGACA
GCACCACAATGGACGCAATACTACTCAGCTCGTGAAGTGTATGGTGCCGCGATTCCCGGTGGCTGGCCAGCAACC
ACGCCGCTGACGCCTGCATTTTGGCATAAGGTAACGGAAGCATTTGAACGGGATGACAACCTCTTCAAGAAGTAC
TTGGAATTCAAAAACCGGGGCATCAATGTTGAAACCTGTGCACCAGGAGCTTGTAAGGATCAAGCCTTATGCCAA
TTACGCGCCGGGAGATCCGAAAGTAACTGTCAAATTACGACTCCCGGCTTGAATTTCAGGAGGAGAGATTCTGAA
GAGTCTCACAAGCATGACGGAAGGCGCAGTACTATTGATCATTGTGAGGGCACGGGTCTGGGAACCATACTCTCA
CAGATGCCAGGCAAGATGGCTGGGGCCAACATCGAAGGTTTAAGGCAGAAGCTAGCAGAGCAATCCATCCAATGG
GAAGGAGTGAAGCATCAAACATAA
Transcript >AgabiH97|110610
ATGAAAACCAGCTGGTTGTTAACTCTTGCTGCAGCATTTTGCTGTATCGGAGGAATAAATGCGGACCTGGTCGAT
GATATCGTGAACGCAATAACTCACGCTGTGGATTGCGCTTCATGCCATGCGCTCCTCCTTCCTCTCGCTGGACTA
GCTCTGATCGGAGACGGCGCACTCACTGGAACCATTACTGCTGTCTGTAAGGCTCTCGGGGTCGAAGACGACGAT
GTCTGTGAAGGCGTGATTGGTGACCAAGGCCCTATTCTGGCTCATGATCTACGTTCCATCTCGCCTTTCGGACGA
ACTGCAACTCTATTGTGTGAAGCTACTTTCGGTCTTTGTCAGGCTCCTGCCGTCAATCAGTTCAAATTTCCGCTC
CCAGCTGCCCCGGTTAATCCGAAGAAATGGACTAGCAGTGGTCGCGAACCATTTCAAGTTGTTCACTTCAGTGAT
GTTCACATAGATCGGGATTACACGCCCGGTGCGGAAGTACAGTGCACGAAACCAATTTGTTGTAGAAATTGGGCG
GATGCGGCTGGAGAGCCAATCAAAGAGGCCGCGGGACCAATAGGAAGTCATAGCTGTGATACCTCGACAAGCCTC
ATTCAGAGCATGCTCCATGCTGCTTCGATTCAAGAGAATTCCTTCTCGATTTTCACAGGTGACGTTATCGAAGCT
GATATTTGGTTGGTGAACCAGAATGGGGTTACGAGTAATTTGAAACAGTTTGACGAGGAAATGCAGACAATCATG
ACGAATTCGGTCTTTCCTGTCATGGGAAATCATGATGTAGCTCCCGTCAATTCGTTCCCTCGTAATACAAGCGAC
GGGGCCACCTCTTCTCAATGGGCTTTTGATGTTCAATCTTCGGGTTGGTCGAAATGGCTCGATGCTTCCGCCATA
GATTCTGTTCAACATATGTCTGGGAGTTATTCAATCCTTGTACCGGGAAGAAATCTTCGCGTCATTTCAATGAAC
GATATTTATTGGTACAAAGCGAATTTCTGGCTCTTTGATAGCGACAACCTCCAACGAGATCCCAATGGTATCCTG
ACCTTTGTTGCGGAGCAACTCCAAGCTGCGGAGGATGCTGGTCAGAGGGCGTGGATCATCGCACACATGCCCCCG
AACAGTGGTGATGCACTCCATGACCAGTCGAACTACTTTGATCAGATTGTCCGGCGATACAGCAATACTATAGCA
GGTCAATTCTATGGTCATACACATCGGGATGAATTCGGTATCTCGTACTCGGATTATGATAATCGCATAGCAGAA
AATGCTATCAGTACTTCATGGATTTGTCCTTCAACAACCCCGCGATCCGGAAACCCTGCATTCAAAGTTTACGAC
GTCGATCCAGATACTTTTGAAGTCATGGACGCAAGGGTATTTTTCAGTGATGTGAATGACGCATCCTTCCAGACA
GCACCACAATGGACGCAATACTACTCAGCTCGTGAAGTGTATGGTGCCGCGATTCCCGGTGGCTGGCCAGCAACC
ACGCCGCTGACGCCTGCATTTTGGCATAAGGTAACGGAAGCATTTGAACGGGATGACAACCTCTTCAAGAAGTAC
TTGGAATTCAAAAACCGGGGCATCAATGTTGAAACCTGTGCACCAGGAGCTTGTAAGGATCAAGCCTTATGCCAA
TTACGCGCCGGGAGATCCGAAAGTAACTGTCAAATTACGACTCCCGGCTTGAATTTCAGGAGGAGAGATTCTGAA
GAGTCTCACAAGCATGACGGAAGGCGCAGTACTATTGATCATTGTGAGGGCACGGGTCTGGGAACCATACTCTCA
CAGATGCCAGGCAAGATGGCTGGGGCCAACATCGAAGGTTTAAGGCAGAAGCTAGCAGAGCAATCCATCCAATGG
GAAGGAGTGAAGCATCAAACATAA
Gene >AgabiH97|110610
ATGAAAACCAGCTGGTTGTTAACTCTTGCTGCAGCATTTTGCTGTATCGGAGGAATAAATGCGGACCTGGTCGAT
GATATCGTGAACGCAATAACTCACGCTGTGGATTGCGCTTCATGCCATGCGCTCCTCCTTCCTCTCGCTGGACTA
GCTCTGATCGGAGACGGCGCACTCACTGGAACCATTACTGCTGTCTGTAAGGCTCTCGGGGTAATTTGGTTCATG
GTGTACATGGAGTTTTAGCATTGATTTTTCGTACTTGCAGGTCGAAGACGACGATGTCTGTGAAGGCGTGATTGG
TGACCAAGGCCCTATTCTGGCTCATGATCTACGTTCCATCTCGCCTTTCGGACGAACTGCAACTCTATTGTGTGA
AGCTACTTTCGGTCTTTGTCAGGCTCCTGCCGTCAATCAGTTCAAATTTCCGCTCCCAGCTGCCCCGGTTAATCC
GAAGAAATGGACTAGCAGTGGTCGCGAACCATTTCAAGTTGTTCACTTCAGTGATGTTCACATAGATCGGGATTA
CACGGTATGCTATCACCTCTACCTCTATGGGTCTATGCTAATGCATCATGCTGTGACTATTTTTTAGCCCGGTGC
GGAAGTACAGTGCACGAAACCAATTTGTTGTAGAAATTGGGCGGATGCGGCTGGAGAGCCAATCAAAGAGGCCGC
GGGACCAATAGGAAGTCATAGCTGTGATACCTCGACAAGCCTCATTCAGAGCATGCTCCATGCTGCTTCGATTCA
AGAGAATTCCTTCTCGATTTTCACAGGTGACGTTATCGAAGGTATGTTATAGTATAGAAATTGACGGTAAAACAA
TTGCACTGATCTCTACATGTTTAGCTGATATTTGGTTGGTGAACCAGAATGGGGTTACGAGTAATTTGAAACAGT
TTGACGAGGAAATGCAGACAATCATGACGAATTCGGTCTTTCCTGTCATGGGTGAGTTTATTTATAACGTGAAGA
ACATTATTTAACATCATCCTTAGGAAATCAGTTAGTCGCACCGTCATCCTCCTTGTAACATTCTAACGCGCCTGC
GCTAGTGATGTAGCTCCCGTCAATTCGTTCCCTCGTAATACAAGCGACGGGGCCACCTCTTCTCAATGGGCTTTT
GATGTTCAATCTTCGGGTTGGTCGGTAAGTTCATACACCTGCAATACGCTATAGTCTCATAGCTGATCACATATC
AGAAATGGCTCGATGCTTCCGCCATAGATTCTGTTCAACATATGTCTGGGAGTTATTCAATCCTTGTACCGGGAA
GAAATCTTCGGTGGGTAGATATAGCCATGTGCTATTCGGCAGCTATTCACCTTCCAACAGCGTCATTTCAATGAA
CGATATTTATTGGTACAAAGCGAAGTAGGTTATGCCGCCGTGAAAAAACTTTAAAATTTTCAACACATTGCTTTC
AAGTTTCTGGCTCTTTGATAGCGACAACCTCCAGTAAGTACCGCTATTCATCTACCTAGTTGCCTCGATTTAATC
CTTTTGGGCCGTATCAGACGAGATCCCAATGGTATCCTGACCTTTGTTGCGGAGCAACTCCAAGCTGCGGAGGAT
GCTGGTCAGAGGGCGTGGATCATCGCACACATGCCCCCGAACAGTGGTGATGCACTCCATGACCAGGTATAAGCG
CCGTTTTCAAACTTGTCACATCTAATTAGATTTGTGCACCAGTCGAACTACTTTGATCAGATTGTCCGGCGATAC
AGCAATACTATAGCAGGTCAATTCTATGGTCATACACATCGGGTGAGTGTTCGCCATTGCTGGTTATAGGTGCTA
TTGCCAATACGTTTCGAAGGATGAATTCGGTATCTCGTACTCGGATTATGATAATCGCATAGCAGAAAATGCTAT
CAGTACTTCATGGATTTGTCCTTCAACAACCCCGCGATGTGAGTACCAAGTCGGCTAATTCGCGCATCAGGGGAG
CAAGCTTGACACTGAGTCTACGTAGCCGGAAACCCTGCATTCAAAGTTTACGACGTCGATCCAGATACTTTTGAA
GTCATGGACGCAAGGGTATTTTTCAGTATGTCTTTCGCAGTCTGTCGTCAGTCCTTGTTGATGTCAATGTGAATG
AAAGGTGATGTGAATGACGCATCCTTCCAGACAGCACGTGAGATGCAGATTATTTATCCGCCGCATATTCTCTTA
GGCTCACTATTCATCCTAGCACAATGGACGCAATACTACTCAGCTCGTGAAGTGTATGGTGCCGCGATTCCCGGT
GGCTGGCCAGCAACCACGCCGCTGACGCCTGCATTTTGGCATAAGGTAACGGAAGCATTTGAACGGGATGACAAC
CTCTTCAAGAAGTACTTGGAATTCAAAAACCGGGGCATCAATGTTGAAACCTGTGCACCAGGAGCTTGTAAGGAT
CAAGCCTTATGCCAATTACGCGCCGGGAGATCCGAAAGTAACTGTGTCAGTGAGGTCTACCTTTTTGCACTGGGC
GGAGGGCTGATTTAGTTATTAGCAAATTACGACTCCCGGCTTGAATTTCAGGAGGAGAGATTCTGAAGAGTCTCA
CAAGCATGACGGAAGGCGCAGTACTATTGATCATTGTGAGGGCACGGGTCTGGGAACCATACTCTCACAGATGCC
AGGCAAGATGGTGAGATATTTGATCAAGGAATCTTATCGCAAGACAGTTCTGAATTTTAACTGCTTAGGCTGGGG
CCAACATCGAAGGTTTAAGGCAGAAGCTAGCAGAGCAATCCATCCAATGGGAAGGAGTGAAGCATCAAACATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail