Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|110530
Gene name
Locationscaffold_8:1135262..1137472
Strand+
Gene length (bp)2210
Transcript length (bp)2157
Coding sequence length (bp)2157
Protein length (aa) 719

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04433 SWIRM SWIRM domain 8.3E-32 132 217
PF16495 SWIRM-assoc_1 SWIRM-associated region 1 4.4E-22 555 633
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 1.4E-11 382 423
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 2.1E-08 383 425

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14470|SSR2_SCHPO SWI/SNF and RSC complexes subunit ssr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssr2 PE=1 SV=3 121 629 4.0E-115
sp|P43609|RSC8_YEAST Chromatin structure-remodeling complex protein RSC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC8 PE=1 SV=1 113 432 3.0E-96
sp|O13788|SSR1_SCHPO SWI/SNF and RSC complexes subunit ssr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssr1 PE=1 SV=1 103 669 2.0E-82
sp|Q92922|SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN=SMARCC1 PE=1 SV=3 72 300 7.0E-60
sp|P97496|SMRC1_MOUSE SWI/SNF complex subunit SMARCC1 OS=Mus musculus GN=Smarcc1 PE=1 SV=2 81 300 2.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14470|SSR2_SCHPO SWI/SNF and RSC complexes subunit ssr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssr2 PE=1 SV=3 121 629 4.0E-115
sp|P43609|RSC8_YEAST Chromatin structure-remodeling complex protein RSC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC8 PE=1 SV=1 113 432 3.0E-96
sp|O13788|SSR1_SCHPO SWI/SNF and RSC complexes subunit ssr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssr1 PE=1 SV=1 103 669 2.0E-82
sp|Q92922|SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN=SMARCC1 PE=1 SV=3 72 300 7.0E-60
sp|P97496|SMRC1_MOUSE SWI/SNF complex subunit SMARCC1 OS=Mus musculus GN=Smarcc1 PE=1 SV=2 81 300 2.0E-58
sp|Q8TAQ2|SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1 125 302 2.0E-57
sp|Q6PDG5|SMRC2_MOUSE SWI/SNF complex subunit SMARCC2 OS=Mus musculus GN=Smarcc2 PE=1 SV=2 125 302 6.0E-57
sp|Q9XI07|SWI3C_ARATH SWI/SNF complex subunit SWI3C OS=Arabidopsis thaliana GN=SWI3C PE=1 SV=1 130 654 1.0E-48
sp|P32591|SWI3_YEAST SWI/SNF complex subunit SWI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI3 PE=1 SV=1 125 257 7.0E-42
sp|Q8W475|SWI3A_ARATH SWI/SNF complex subunit SWI3A OS=Arabidopsis thaliana GN=SWI3A PE=1 SV=1 123 426 3.0E-29
sp|Q8TAQ2|SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1 362 482 1.0E-26
sp|Q6PDG5|SMRC2_MOUSE SWI/SNF complex subunit SMARCC2 OS=Mus musculus GN=Smarcc2 PE=1 SV=2 362 482 1.0E-26
sp|P32591|SWI3_YEAST SWI/SNF complex subunit SWI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI3 PE=1 SV=1 382 625 6.0E-25
sp|Q84JG2|SWI3B_ARATH SWI/SNF complex subunit SWI3B OS=Arabidopsis thaliana GN=SWI3B PE=1 SV=1 129 625 3.0E-23
sp|P97496|SMRC1_MOUSE SWI/SNF complex subunit SMARCC1 OS=Mus musculus GN=Smarcc1 PE=1 SV=2 376 482 7.0E-22
sp|Q92922|SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN=SMARCC1 PE=1 SV=3 376 482 7.0E-22
sp|Q54J55|MYBX_DICDI Myb-like protein X OS=Dictyostelium discoideum GN=mybX PE=3 SV=1 322 483 1.0E-21
sp|Q8VY05|SWI3D_ARATH SWI/SNF complex subunit SWI3D OS=Arabidopsis thaliana GN=SWI3D PE=1 SV=3 316 431 6.0E-16
sp|Q8VY05|SWI3D_ARATH SWI/SNF complex subunit SWI3D OS=Arabidopsis thaliana GN=SWI3D PE=1 SV=3 83 218 8.0E-14
sp|Q9ATB4|TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidopsis thaliana GN=ADA2B PE=1 SV=1 287 431 4.0E-08
sp|Q5RGA4|MYSM1_DANRE Histone H2A deubiquitinase MYSM1 OS=Danio rerio GN=mysm1 PE=2 SV=2 138 220 6.0E-08
sp|Q75LL6|TADA2_ORYSJ Transcriptional adapter ADA2 OS=Oryza sativa subsp. japonica GN=ADA2 PE=2 SV=2 320 421 9.0E-08
sp|Q92922|SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN=SMARCC1 PE=1 SV=3 472 622 3.0E-07
sp|Q5F3F2|MYSM1_CHICK Histone H2A deubiquitinase MYSM1 OS=Gallus gallus GN=MYSM1 PE=2 SV=1 138 217 3.0E-07
sp|B6MUN4|MYSM1_BRAFL Histone H2A deubiquitinase MYSM1 OS=Branchiostoma floridae GN=MYSM1 PE=3 SV=1 115 224 3.0E-06
sp|Q59WH0|ADA2_CANAL Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADA2 PE=3 SV=1 322 427 4.0E-06
sp|A0JMR6|MYSM1_XENLA Histone H2A deubiquitinase MYSM1 OS=Xenopus laevis GN=mysm1 PE=2 SV=1 138 217 5.0E-06
sp|P97496|SMRC1_MOUSE SWI/SNF complex subunit SMARCC1 OS=Mus musculus GN=Smarcc1 PE=1 SV=2 483 622 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|110530
MDSPKRAGSATPQNDPKRIKLAVNHGATPVDPDNAPGKRNEQDPIQSTDIANLHPENAPTHDPPPSVRVRQLKDG
EEDEPGDVSMADGADDDGDSADDNDDEDPAQLEATRLRLEEQARKYLAAQTHEIIIPSYSNWFDMSKIHPVERRA
VPEFFNSRNRSKTPSIYKDYRDFMINTYRLRPTEYLTVTACRRNLAGDVCAIMRVHAFLEQWGLINYQIDPEQRP
AALSPPFTGHFRVILDTPRGLQSLHPGTRPSVPNATAGGAPANVKAPSATPASLELRSSIYQTTSKSSKALSSAE
ATTLANGASNGTSHTPQHTHTCDVCGADCSQVRYHCLKDKKLEVCAPCYLDGRFPSTLFSGDFVKLTTAPPGIAG
ASSANNDWSDQETLLLLEGVEMYDDDWSKVEEHVGTRTAQQCIRRFLELPIEDPYLQTEGNMGPLRFGRIPFDQA
DNPIMSVVAFLAGVVNSSVAAEAAKTALKELTDGESGKKSEKGEGEKKDEDKMDEDVPSSRQSPPESASSSDPTK
ISTTTTTTMTSTTTTTHTLPHSQVQRAAHLALSASAKAAQNLATAEDQQIRGTLSNLIKLTLTKLEIKMSQFEEL
EEILEEERRNLESARVALVNERLGLKKMLDTVRGEVVRHQQQQQQQQLAVATGGPSSSASQQQQQPGFSQGVINA
ATNPGMALGMSGQGPIVNEVQSSAMNVEGGEGPVQDGQTLQLS*
Coding >AgabiH97|110530
ATGGACTCGCCAAAACGCGCTGGCTCTGCAACTCCCCAGAACGACCCCAAGCGCATCAAGCTCGCCGTCAACCAC
GGCGCTACCCCCGTCGACCCCGACAACGCCCCCGGGAAGCGCAACGAGCAGGACCCCATCCAGTCCACCGACATC
GCAAACCTCCACCCCGAAAATGCCCCGACCCACGACCCCCCGCCGTCTGTCCGCGTCAGGCAGCTCAAAGACGGC
GAGGAGGACGAACCTGGTGACGTGTCCATGGCCGACGGCGCTGACGATGACGGCGACTCGGCGGACGACAACGAC
GACGAAGACCCTGCCCAGCTCGAGGCTACCCGTCTGCGTCTCGAAGAGCAGGCGCGCAAGTATCTGGCCGCCCAG
ACCCACGAAATCATCATCCCAAGCTATTCCAATTGGTTTGACATGTCCAAAATCCACCCCGTCGAAAGACGAGCC
GTCCCCGAATTTTTCAACTCGCGCAACCGTTCAAAGACTCCGTCCATATACAAGGACTACCGCGACTTTATGATC
AACACCTACCGTCTCCGCCCCACAGAGTATCTCACTGTCACCGCCTGCCGTAGAAATCTGGCCGGCGACGTCTGT
GCTATCATGCGCGTACACGCCTTTCTCGAGCAATGGGGCCTGATCAACTACCAGATCGACCCCGAGCAACGCCCA
GCAGCCCTTTCTCCTCCCTTCACTGGCCACTTCCGCGTCATCCTCGACACCCCACGCGGCCTCCAGTCCCTCCAC
CCCGGCACGCGACCTTCCGTTCCAAACGCCACCGCTGGTGGGGCACCTGCCAATGTAAAAGCGCCTTCAGCCACC
CCAGCCTCTCTCGAACTTCGTTCCTCCATCTACCAAACCACATCCAAATCCTCCAAGGCCCTCTCTTCCGCCGAA
GCCACGACTCTCGCAAATGGCGCTTCCAACGGCACTTCGCATACTCCACAGCACACACATACGTGTGACGTTTGT
GGTGCAGATTGTTCTCAAGTCCGTTATCACTGCCTAAAAGACAAAAAACTTGAAGTTTGCGCCCCTTGTTATCTT
GATGGTCGCTTCCCATCGACGCTTTTCTCTGGGGATTTCGTCAAATTAACGACAGCGCCACCTGGTATCGCTGGT
GCTTCTTCCGCGAACAACGATTGGTCCGACCAAGAAACCCTTCTTCTACTGGAAGGTGTCGAAATGTACGATGAC
GATTGGTCAAAAGTTGAAGAACATGTCGGCACTCGTACCGCACAACAGTGTATTCGCAGATTCTTGGAATTACCG
ATCGAGGATCCGTATCTACAAACGGAAGGAAATATGGGTCCTCTTCGATTCGGCAGAATACCTTTTGACCAGGCA
GATAATCCTATTATGAGCGTTGTGGCTTTCCTTGCGGGCGTCGTCAACTCGAGCGTGGCTGCTGAAGCTGCCAAG
ACGGCCTTGAAAGAATTGACGGATGGAGAAAGTGGGAAGAAGTCGGAGAAAGGTGAAGGGGAGAAGAAAGACGAG
GATAAGATGGACGAGGATGTACCTTCATCTCGTCAGAGTCCTCCCGAATCTGCTTCCTCTTCTGATCCCACAAAA
ATCAGCACAACCACGACGACGACAATGACATCCACGACAACGACAACCCACACCCTCCCTCACTCTCAAGTTCAA
AGAGCGGCTCATCTCGCTCTCAGCGCTTCAGCTAAAGCAGCCCAAAATCTCGCCACAGCCGAAGATCAACAAATC
CGGGGCACACTGTCCAACCTCATCAAACTGACTTTGACAAAGTTGGAAATTAAAATGTCGCAATTTGAGGAATTG
GAGGAGATATTGGAGGAGGAGAGGAGGAATTTGGAGAGTGCGAGGGTTGCGTTGGTGAATGAGAGGTTGGGGTTG
AAGAAGATGTTGGATACGGTTAGAGGGGAGGTTGTTCGACATCAACAACAGCAGCAGCAGCAGCAATTGGCTGTG
GCTACTGGTGGACCGTCGTCGTCAGCATCTCAACAACAACAACAACCGGGGTTTTCGCAAGGCGTGATTAATGCT
GCGACGAATCCGGGTATGGCGTTGGGGATGAGTGGACAAGGACCGATTGTGAATGAAGTACAATCTTCGGCTATG
AATGTAGAAGGTGGTGAGGGTCCTGTACAGGATGGGCAGACGTTACAGTTGAGTTGA
Transcript >AgabiH97|110530
ATGGACTCGCCAAAACGCGCTGGCTCTGCAACTCCCCAGAACGACCCCAAGCGCATCAAGCTCGCCGTCAACCAC
GGCGCTACCCCCGTCGACCCCGACAACGCCCCCGGGAAGCGCAACGAGCAGGACCCCATCCAGTCCACCGACATC
GCAAACCTCCACCCCGAAAATGCCCCGACCCACGACCCCCCGCCGTCTGTCCGCGTCAGGCAGCTCAAAGACGGC
GAGGAGGACGAACCTGGTGACGTGTCCATGGCCGACGGCGCTGACGATGACGGCGACTCGGCGGACGACAACGAC
GACGAAGACCCTGCCCAGCTCGAGGCTACCCGTCTGCGTCTCGAAGAGCAGGCGCGCAAGTATCTGGCCGCCCAG
ACCCACGAAATCATCATCCCAAGCTATTCCAATTGGTTTGACATGTCCAAAATCCACCCCGTCGAAAGACGAGCC
GTCCCCGAATTTTTCAACTCGCGCAACCGTTCAAAGACTCCGTCCATATACAAGGACTACCGCGACTTTATGATC
AACACCTACCGTCTCCGCCCCACAGAGTATCTCACTGTCACCGCCTGCCGTAGAAATCTGGCCGGCGACGTCTGT
GCTATCATGCGCGTACACGCCTTTCTCGAGCAATGGGGCCTGATCAACTACCAGATCGACCCCGAGCAACGCCCA
GCAGCCCTTTCTCCTCCCTTCACTGGCCACTTCCGCGTCATCCTCGACACCCCACGCGGCCTCCAGTCCCTCCAC
CCCGGCACGCGACCTTCCGTTCCAAACGCCACCGCTGGTGGGGCACCTGCCAATGTAAAAGCGCCTTCAGCCACC
CCAGCCTCTCTCGAACTTCGTTCCTCCATCTACCAAACCACATCCAAATCCTCCAAGGCCCTCTCTTCCGCCGAA
GCCACGACTCTCGCAAATGGCGCTTCCAACGGCACTTCGCATACTCCACAGCACACACATACGTGTGACGTTTGT
GGTGCAGATTGTTCTCAAGTCCGTTATCACTGCCTAAAAGACAAAAAACTTGAAGTTTGCGCCCCTTGTTATCTT
GATGGTCGCTTCCCATCGACGCTTTTCTCTGGGGATTTCGTCAAATTAACGACAGCGCCACCTGGTATCGCTGGT
GCTTCTTCCGCGAACAACGATTGGTCCGACCAAGAAACCCTTCTTCTACTGGAAGGTGTCGAAATGTACGATGAC
GATTGGTCAAAAGTTGAAGAACATGTCGGCACTCGTACCGCACAACAGTGTATTCGCAGATTCTTGGAATTACCG
ATCGAGGATCCGTATCTACAAACGGAAGGAAATATGGGTCCTCTTCGATTCGGCAGAATACCTTTTGACCAGGCA
GATAATCCTATTATGAGCGTTGTGGCTTTCCTTGCGGGCGTCGTCAACTCGAGCGTGGCTGCTGAAGCTGCCAAG
ACGGCCTTGAAAGAATTGACGGATGGAGAAAGTGGGAAGAAGTCGGAGAAAGGTGAAGGGGAGAAGAAAGACGAG
GATAAGATGGACGAGGATGTACCTTCATCTCGTCAGAGTCCTCCCGAATCTGCTTCCTCTTCTGATCCCACAAAA
ATCAGCACAACCACGACGACGACAATGACATCCACGACAACGACAACCCACACCCTCCCTCACTCTCAAGTTCAA
AGAGCGGCTCATCTCGCTCTCAGCGCTTCAGCTAAAGCAGCCCAAAATCTCGCCACAGCCGAAGATCAACAAATC
CGGGGCACACTGTCCAACCTCATCAAACTGACTTTGACAAAGTTGGAAATTAAAATGTCGCAATTTGAGGAATTG
GAGGAGATATTGGAGGAGGAGAGGAGGAATTTGGAGAGTGCGAGGGTTGCGTTGGTGAATGAGAGGTTGGGGTTG
AAGAAGATGTTGGATACGGTTAGAGGGGAGGTTGTTCGACATCAACAACAGCAGCAGCAGCAGCAATTGGCTGTG
GCTACTGGTGGACCGTCGTCGTCAGCATCTCAACAACAACAACAACCGGGGTTTTCGCAAGGCGTGATTAATGCT
GCGACGAATCCGGGTATGGCGTTGGGGATGAGTGGACAAGGACCGATTGTGAATGAAGTACAATCTTCGGCTATG
AATGTAGAAGGTGGTGAGGGTCCTGTACAGGATGGGCAGACGTTACAGTTGAGTTGA
Gene >AgabiH97|110530
ATGGACTCGCCAAAACGCGCTGGCTCTGCAACTCCCCAGAACGACCCCAAGCGCATCAAGCTCGCCGTCAACCAC
GGCGCTACCCCCGTCGACCCCGACAACGCCCCCGGGAAGCGCAACGAGCAGGACCCCATCCAGTCCACCGACATC
GCAAACCTCCACCCCGAAAATGCCCCGACCCACGACCCCCCGCCGTCTGTCCGCGTCAGGCAGCTCAAAGACGGC
GAGGAGGACGAACCTGGTGACGTGTCCATGGCCGACGGCGCTGACGATGACGGCGACTCGGCGGACGACAACGAC
GACGAAGACCCTGCCCAGCTCGAGGCTACCCGTCTGCGTCTCGAAGAGCAGGCGCGCAAGTATCTGGCCGCCCAG
ACCCACGAAATCATCATCCCAAGCTATTCCAATTGGTTTGACATGTCCAAAATCCACCCCGTCGAAAGACGAGCC
GTCCCCGAATTTTTCAACTCGCGCAACCGTTCAAAGACTCCGTCCATATACAAGGACTACCGCGACTTTATGATC
AACACCTACCGTCTCCGCCCCACAGAGTATCTCACTGTCACCGCCTGCCGTAGAAATCTGGCCGGCGACGTCTGT
GCTATCATGCGCGTACACGCCTTTCTCGAGCAATGGGGCCTGATCAACTACCAGGTTAGATTCATGTTCTTCATC
TCTCACATTAGACCTTATTTTTCATTCATTAGATCGACCCCGAGCAACGCCCAGCAGCCCTTTCTCCTCCCTTCA
CTGGCCACTTCCGCGTCATCCTCGACACCCCACGCGGCCTCCAGTCCCTCCACCCCGGCACGCGACCTTCCGTTC
CAAACGCCACCGCTGGTGGGGCACCTGCCAATGTAAAAGCGCCTTCAGCCACCCCAGCCTCTCTCGAACTTCGTT
CCTCCATCTACCAAACCACATCCAAATCCTCCAAGGCCCTCTCTTCCGCCGAAGCCACGACTCTCGCAAATGGCG
CTTCCAACGGCACTTCGCATACTCCACAGCACACACATACGTGTGACGTTTGTGGTGCAGATTGTTCTCAAGTCC
GTTATCACTGCCTAAAAGACAAAAAACTTGAAGTTTGCGCCCCTTGTTATCTTGATGGTCGCTTCCCATCGACGC
TTTTCTCTGGGGATTTCGTCAAATTAACGACAGCGCCACCTGGTATCGCTGGTGCTTCTTCCGCGAACAACGATT
GGTCCGACCAAGAAACCCTTCTTCTACTGGAAGGTGTCGAAATGTACGATGACGATTGGTCAAAAGTTGAAGAAC
ATGTCGGCACTCGTACCGCACAACAGTGTATTCGCAGATTCTTGGAATTACCGATCGAGGATCCGTATCTACAAA
CGGAAGGAAATATGGGTCCTCTTCGATTCGGCAGAATACCTTTTGACCAGGCAGATAATCCTATTATGAGCGTTG
TGGCTTTCCTTGCGGGCGTCGTCAACTCGAGCGTGGCTGCTGAAGCTGCCAAGACGGCCTTGAAAGAATTGACGG
ATGGAGAAAGTGGGAAGAAGTCGGAGAAAGGTGAAGGGGAGAAGAAAGACGAGGATAAGATGGACGAGGATGTAC
CTTCATCTCGTCAGAGTCCTCCCGAATCTGCTTCCTCTTCTGATCCCACAAAAATCAGCACAACCACGACGACGA
CAATGACATCCACGACAACGACAACCCACACCCTCCCTCACTCTCAAGTTCAAAGAGCGGCTCATCTCGCTCTCA
GCGCTTCAGCTAAAGCAGCCCAAAATCTCGCCACAGCCGAAGATCAACAAATCCGGGGCACACTGTCCAACCTCA
TCAAACTGACTTTGACAAAGTTGGAAATTAAAATGTCGCAATTTGAGGAATTGGAGGAGATATTGGAGGAGGAGA
GGAGGAATTTGGAGAGTGCGAGGGTTGCGTTGGTGAATGAGAGGTTGGGGTTGAAGAAGATGTTGGATACGGTTA
GAGGGGAGGTTGTTCGACATCAACAACAGCAGCAGCAGCAGCAATTGGCTGTGGCTACTGGTGGACCGTCGTCGT
CAGCATCTCAACAACAACAACAACCGGGGTTTTCGCAAGGCGTGATTAATGCTGCGACGAATCCGGGTATGGCGT
TGGGGATGAGTGGACAAGGACCGATTGTGAATGAAGTACAATCTTCGGCTATGAATGTAGAAGGTGGTGAGGGTC
CTGTACAGGATGGGCAGACGTTACAGTTGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail