Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|110520
Gene name
Locationscaffold_8:1133509..1135170
Strand-
Gene length (bp)1661
Transcript length (bp)1560
Coding sequence length (bp)1560
Protein length (aa) 520

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 4.3E-14 10 334
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 8.4E-10 5 69

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10062|PPOX_SCHPO Protoporphyrinogen oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem14 PE=3 SV=1 1 511 1.0E-55
sp|P50336|PPOX_HUMAN Protoporphyrinogen oxidase OS=Homo sapiens GN=PPOX PE=1 SV=1 3 519 1.0E-43
sp|Q60HD5|PPOX_MACFA Protoporphyrinogen oxidase OS=Macaca fascicularis GN=PPOX PE=2 SV=1 3 519 3.0E-42
sp|P51175|PPOX_MOUSE Protoporphyrinogen oxidase OS=Mus musculus GN=Ppox PE=1 SV=1 3 519 2.0E-39
sp|P56602|PPOX_BOVIN Protoporphyrinogen oxidase OS=Bos taurus GN=PPOX PE=1 SV=2 3 514 6.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10062|PPOX_SCHPO Protoporphyrinogen oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem14 PE=3 SV=1 1 511 1.0E-55
sp|P50336|PPOX_HUMAN Protoporphyrinogen oxidase OS=Homo sapiens GN=PPOX PE=1 SV=1 3 519 1.0E-43
sp|Q60HD5|PPOX_MACFA Protoporphyrinogen oxidase OS=Macaca fascicularis GN=PPOX PE=2 SV=1 3 519 3.0E-42
sp|P51175|PPOX_MOUSE Protoporphyrinogen oxidase OS=Mus musculus GN=Ppox PE=1 SV=1 3 519 2.0E-39
sp|P56602|PPOX_BOVIN Protoporphyrinogen oxidase OS=Bos taurus GN=PPOX PE=1 SV=2 3 514 6.0E-36
sp|Q54DT8|PPOX_DICDI Protoporphyrinogen oxidase OS=Dictyostelium discoideum GN=ppox PE=3 SV=1 2 508 6.0E-25
sp|P32397|PPOX_BACSU Protoporphyrinogen oxidase OS=Bacillus subtilis (strain 168) GN=hemY PE=1 SV=1 3 514 1.0E-15
sp|P56601|PPOX_MYXXA Protoporphyrinogen oxidase OS=Myxococcus xanthus GN=hemY PE=1 SV=1 1 514 1.0E-13
sp|P40012|PPOX_YEAST Protoporphyrinogen oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM14 PE=1 SV=1 9 402 3.0E-10
sp|O32434|PPOX_PROFF Protoporphyrinogen oxidase OS=Propionibacterium freudenreichii subsp. freudenreichii GN=hemY PE=3 SV=1 2 187 3.0E-10
sp|Q9AR38|PPOC_ORYSJ Protoporphyrinogen oxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=PPOX1 PE=2 SV=1 5 178 1.0E-08
sp|Q8S9J1|PPOCM_ARATH Protoporphyrinogen oxidase 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PPOX2 PE=1 SV=1 2 358 3.0E-07
sp|O24164|PPOM_TOBAC Protoporphyrinogen oxidase, mitochondrial OS=Nicotiana tabacum GN=PPXII PE=1 SV=1 2 371 5.0E-07
sp|P55826|PPOC_ARATH Protoporphyrinogen oxidase 1, chloroplastic OS=Arabidopsis thaliana GN=PPOX1 PE=1 SV=1 5 178 1.0E-06
sp|Q94IG7|PPOCM_SPIOL Protoporphyrinogen oxidase, chloroplastic/mitochondrial OS=Spinacia oleracea GN=POX2 PE=1 SV=1 2 347 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|110520
MQIAVLGGGLSGLGAAHALAHRFPAAQLLLFERGRPLGGWAQSLRHGRILLEGGPRTLRPNGAAALELIRALGIE
NQLLVVPKSSPASKNRYVYIRPGQLPGFSGLCVVGPSLLRQFLWPIIRAPLRYALYKNAPKDESVDSFMSRILGD
DMATALGSALIHGIYAADSRQLSAHATLPFFSSKDRKKFLENPVSNFESDVLQPWPNVGNLYNKLEHASAFSFKD
GMETLTRALEEHLEAKSNVQIFRESPVLSLAMRKDRTMQLSYLRSGSTSTSISTVNLTHVVSALPLPTLHTITQP
RNTNDTFPSNVPLHLNANPSSSVHVLNLVFPGPPVNIHPSGFGYLIPRPREGYPTQATDAQPGILGVVFDSCTCS
EQDDSNLTPEEWYHKGTHTKITVMLDGPYPLYIPPTTPNFLTSTTDIPHPIQIILKHLSTHFSQLKSNYALPPPT
YYHLWRNVNCIPTYLPGHRSRMDEMKTMLKKDVSEGGWNGKLEVIGAGVDGVSVPDCLLAGRNAGLSWL*
Coding >AgabiH97|110520
ATGCAGATTGCAGTCCTCGGCGGCGGGCTCTCGGGACTCGGCGCCGCCCACGCCCTCGCTCACCGATTCCCGGCC
GCACAGCTCCTCCTCTTCGAACGCGGCAGGCCCCTCGGCGGCTGGGCCCAGTCGCTCCGCCACGGCCGGATACTT
CTCGAGGGAGGGCCGCGCACCCTCCGGCCGAACGGCGCTGCTGCCCTCGAACTCATCAGAGCCCTCGGCATCGAG
AACCAGCTCCTTGTGGTTCCCAAATCCTCTCCGGCCTCCAAGAACCGGTATGTGTACATCCGCCCCGGACAGCTG
CCCGGCTTCTCCGGCCTCTGCGTTGTCGGTCCCTCTCTTCTGAGGCAATTTCTCTGGCCCATTATACGCGCACCA
CTGCGCTATGCCCTCTATAAGAACGCACCAAAGGACGAGTCCGTCGATTCATTCATGTCGCGCATTCTCGGAGAC
GACATGGCCACCGCTCTCGGCAGCGCCCTCATCCACGGCATTTATGCTGCAGACTCGCGTCAGCTAAGCGCGCAT
GCCACCTTGCCCTTCTTCTCTTCCAAAGATCGTAAAAAGTTTCTTGAGAACCCAGTTTCGAATTTCGAATCTGAT
GTATTACAACCTTGGCCGAATGTCGGGAATCTGTATAACAAACTCGAGCACGCTTCCGCCTTCTCTTTCAAGGAT
GGCATGGAAACCTTGACCCGGGCTCTCGAGGAGCATCTGGAAGCCAAGTCCAACGTACAAATCTTCCGCGAGAGC
CCAGTCCTCAGTCTTGCCATGCGCAAGGATCGCACTATGCAACTATCTTATTTGCGTTCTGGTAGTACCAGTACT
TCCATATCCACAGTCAATCTCACCCATGTCGTGTCCGCACTTCCTCTCCCCACCCTTCACACCATAACCCAACCT
CGGAACACCAACGACACTTTTCCCTCAAACGTTCCATTACACCTCAACGCAAATCCTTCCTCTTCAGTTCACGTT
CTCAACCTTGTCTTTCCAGGCCCTCCAGTTAATATTCATCCTTCCGGCTTTGGTTATCTCATCCCCCGACCTCGA
GAAGGCTATCCTACCCAAGCGACTGATGCCCAACCGGGAATCCTTGGTGTCGTATTCGACTCTTGTACATGTTCA
GAACAAGACGATTCAAATCTAACACCAGAAGAATGGTACCACAAAGGCACTCACACCAAAATTACCGTAATGCTC
GATGGACCCTATCCTCTCTACATCCCCCCAACCACACCCAACTTCCTCACATCAACAACAGACATTCCTCATCCT
ATTCAAATTATCCTCAAACATCTTTCTACGCATTTTTCTCAACTCAAGTCTAATTATGCTTTACCTCCGCCTACA
TATTATCATCTGTGGCGCAACGTCAATTGCATTCCGACGTATTTACCTGGACATCGCTCAAGAATGGACGAAATG
AAAACCATGTTGAAAAAAGATGTTAGTGAAGGTGGTTGGAATGGTAAACTTGAAGTTATAGGAGCCGGTGTTGAT
GGTGTCAGTGTACCAGATTGTTTACTCGCCGGAAGGAATGCTGGTTTATCGTGGCTGTGA
Transcript >AgabiH97|110520
ATGCAGATTGCAGTCCTCGGCGGCGGGCTCTCGGGACTCGGCGCCGCCCACGCCCTCGCTCACCGATTCCCGGCC
GCACAGCTCCTCCTCTTCGAACGCGGCAGGCCCCTCGGCGGCTGGGCCCAGTCGCTCCGCCACGGCCGGATACTT
CTCGAGGGAGGGCCGCGCACCCTCCGGCCGAACGGCGCTGCTGCCCTCGAACTCATCAGAGCCCTCGGCATCGAG
AACCAGCTCCTTGTGGTTCCCAAATCCTCTCCGGCCTCCAAGAACCGGTATGTGTACATCCGCCCCGGACAGCTG
CCCGGCTTCTCCGGCCTCTGCGTTGTCGGTCCCTCTCTTCTGAGGCAATTTCTCTGGCCCATTATACGCGCACCA
CTGCGCTATGCCCTCTATAAGAACGCACCAAAGGACGAGTCCGTCGATTCATTCATGTCGCGCATTCTCGGAGAC
GACATGGCCACCGCTCTCGGCAGCGCCCTCATCCACGGCATTTATGCTGCAGACTCGCGTCAGCTAAGCGCGCAT
GCCACCTTGCCCTTCTTCTCTTCCAAAGATCGTAAAAAGTTTCTTGAGAACCCAGTTTCGAATTTCGAATCTGAT
GTATTACAACCTTGGCCGAATGTCGGGAATCTGTATAACAAACTCGAGCACGCTTCCGCCTTCTCTTTCAAGGAT
GGCATGGAAACCTTGACCCGGGCTCTCGAGGAGCATCTGGAAGCCAAGTCCAACGTACAAATCTTCCGCGAGAGC
CCAGTCCTCAGTCTTGCCATGCGCAAGGATCGCACTATGCAACTATCTTATTTGCGTTCTGGTAGTACCAGTACT
TCCATATCCACAGTCAATCTCACCCATGTCGTGTCCGCACTTCCTCTCCCCACCCTTCACACCATAACCCAACCT
CGGAACACCAACGACACTTTTCCCTCAAACGTTCCATTACACCTCAACGCAAATCCTTCCTCTTCAGTTCACGTT
CTCAACCTTGTCTTTCCAGGCCCTCCAGTTAATATTCATCCTTCCGGCTTTGGTTATCTCATCCCCCGACCTCGA
GAAGGCTATCCTACCCAAGCGACTGATGCCCAACCGGGAATCCTTGGTGTCGTATTCGACTCTTGTACATGTTCA
GAACAAGACGATTCAAATCTAACACCAGAAGAATGGTACCACAAAGGCACTCACACCAAAATTACCGTAATGCTC
GATGGACCCTATCCTCTCTACATCCCCCCAACCACACCCAACTTCCTCACATCAACAACAGACATTCCTCATCCT
ATTCAAATTATCCTCAAACATCTTTCTACGCATTTTTCTCAACTCAAGTCTAATTATGCTTTACCTCCGCCTACA
TATTATCATCTGTGGCGCAACGTCAATTGCATTCCGACGTATTTACCTGGACATCGCTCAAGAATGGACGAAATG
AAAACCATGTTGAAAAAAGATGTTAGTGAAGGTGGTTGGAATGGTAAACTTGAAGTTATAGGAGCCGGTGTTGAT
GGTGTCAGTGTACCAGATTGTTTACTCGCCGGAAGGAATGCTGGTTTATCGTGGCTGTGA
Gene >AgabiH97|110520
ATGCAGATTGCAGTCCTCGGCGGCGGGCTCTCGGGACTCGGCGCCGCCCACGCCCTCGCTCACCGATTCCCGGCC
GCACAGCTCCTCCTCTTCGAACGCGGCAGGCCCCTCGGCGGCTGGGCCCAGTCGCTCCGCCACGGCCGGATACTT
CTCGAGGGAGGGCCGCGCACCCTCCGGCCGAACGGCGCTGCTGCCCTCGAACTCGTGCGTCCTGTCTCCTCTTCA
ACTCGGCTGCGTATTGACTTTCGCACAGATCAGAGCCCTCGGCATCGAGAACCAGCTCCTTGTGGTTCCCAAATC
CTCTCCGGCCTCCAAGAACCGGTATGTGTACATCCGCCCCGGACAGCTGCCCGGCTTCTCCGGCCTCTGCGTTGT
CGGTCCCTCTCTTCTGAGGCAATTTCTCTGGCCCATTATACGCGCACCACTGCGCTATGCCCTCTATAAGAACGC
ACCAAAGGACGAGTCCGTCGATTCATTCATGTCGCGCATTCTCGGAGACGACATGGCCACCGCTCTCGGCAGCGC
CCTCATCCACGGCATTTATGCTGCAGACTCGCGTCAGCTAAGCGCGCATGCCACCTTGCCCTTCTTCTCTTCCAA
AGATCGTAAAAAGTTTCTTGAGAACCCAGTTTCGAATTTCGAATCTGATGTATTACAACCTTGGCCGAATGTCGG
GAATCTGTATAACAAACTCGAGCACGCTTCCGCCTTCTCTTTCAAGGATGGCATGGAAACCTTGACCCGGGCTCT
CGAGGAGCATCTGGAAGCCAAGTCCAACGTACAAATCTTCCGCGAGAGCCCAGTCCTCAGTCTTGCCATGCGCAA
GGATCGCACTATGCAAGTACGTCATTCCTCATTTTCTTTTTTGCACGATAAATTAATGTCCTCATCAGCTATCTT
ATTTGCGTTCTGGTAGTACCAGTACTTCCATATCCACAGTCAATCTCACCCATGTCGTGTCCGCACTTCCTCTCC
CCACCCTTCACACCATAACCCAACCTCGGAACACCAACGACACTTTTCCCTCAAACGTTCCATTACACCTCAACG
CAAATCCTTCCTCTTCAGTTCACGTTCTCAACCTTGTCTTTCCAGGCCCTCCAGTTAATATTCATCCTTCCGGCT
TTGGTTATCTCATCCCCCGACCTCGAGAAGGCTATCCTACCCAAGCGACTGATGCCCAACCGGGAATCCTTGGTG
TCGTATTCGACTCTTGTACATGTTCAGAACAAGACGATTCAAATCTAACACCAGAAGAATGGTACCACAAAGGCA
CTCACACCAAAATTACCGTAATGCTCGATGGACCCTATCCTCTCTACATCCCCCCAACCACACCCAACTTCCTCA
CATCAACAACAGACATTCCTCATCCTATTCAAATTATCCTCAAACATCTTTCTACGCATTTTTCTCAACTCAAGT
CTAATTATGCTTTACCTCCGCCTACATATTATCATCTGTGGCGCAACGTCAATTGCATTCCGACGTATTTACCTG
GACATCGCTCAAGAATGGACGAAATGAAAACCATGTTGAAAAAAGATGTTAGTGAAGGTGGTTGGAATGGTAAAC
TTGAAGTTATAGGAGCCGGTGTTGATGGTGTCAGTGTACCAGATTGTTTACTCGCCGGAAGGAATGCTGGTTTAT
CGTGGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail