Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|110430
Gene name
Locationscaffold_8:1120208..1121541
Strand+
Gene length (bp)1333
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07745 Glyco_hydro_53 Glycosyl hydrolase family 53 3.3E-82 24 349

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1D3T4|GANA_NEOFI Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=galA PE=3 SV=1 9 349 2.0E-94
sp|B0XPR3|GANA_ASPFC Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=galA PE=3 SV=2 19 350 3.0E-92
sp|Q4WJ80|GANA_ASPFU Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=galA PE=3 SV=2 19 350 4.0E-91
sp|P83692|GANA_THIHE Arabinogalactan endo-beta-1,4-galactanase OS=Thielavia heterothallica PE=1 SV=1 21 349 3.0E-89
sp|Q5B153|GANA_EMENI Arabinogalactan endo-beta-1,4-galactanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=galA PE=1 SV=2 15 351 2.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1D3T4|GANA_NEOFI Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=galA PE=3 SV=1 9 349 2.0E-94
sp|B0XPR3|GANA_ASPFC Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=galA PE=3 SV=2 19 350 3.0E-92
sp|Q4WJ80|GANA_ASPFU Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=galA PE=3 SV=2 19 350 4.0E-91
sp|P83692|GANA_THIHE Arabinogalactan endo-beta-1,4-galactanase OS=Thielavia heterothallica PE=1 SV=1 21 349 3.0E-89
sp|Q5B153|GANA_EMENI Arabinogalactan endo-beta-1,4-galactanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=galA PE=1 SV=2 15 351 2.0E-88
sp|P83691|GANA_HUMIN Arabinogalactan endo-beta-1,4-galactanase OS=Humicola insolens PE=1 SV=1 21 349 5.0E-88
sp|Q0CTQ7|GANA_ASPTN Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=galA PE=3 SV=1 19 349 1.0E-86
sp|B8NNI2|GANA_ASPFN Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=galA PE=3 SV=1 2 349 5.0E-86
sp|Q2UN61|GANA_ASPOR Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=galA PE=3 SV=1 2 349 2.0E-85
sp|P48842|GANA_ASPAC Arabinogalactan endo-beta-1,4-galactanase OS=Aspergillus aculeatus GN=gal1 PE=1 SV=1 23 337 2.0E-85
sp|Q8X168|GANA_ASPNG Arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger GN=galA PE=1 SV=1 23 337 1.0E-84
sp|A2RB93|GANA_ASPNC Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=galA PE=3 SV=1 23 337 1.0E-84
sp|Q9Y7F8|GANA_ASPTU Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis GN=galA PE=2 SV=1 23 351 1.0E-84
sp|P48843|YBAB_BACCI Uncharacterized protein in bgaB 5'region (Fragment) OS=Bacillus circulans PE=3 SV=1 26 321 2.0E-41
sp|Q65CX5|GANA_BACLD Arabinogalactan endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ganB PE=1 SV=1 25 321 4.0E-37
sp|O07013|GANA_BACSU Arabinogalactan endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) GN=ganB PE=1 SV=1 25 321 2.0E-36
sp|P48841|GANA_CELJU Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) GN=ganB PE=1 SV=1 24 321 3.0E-33
[Show less]

GO

GO Term Description Terminal node
GO:0015926 glucosidase activity Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|110430
MILFSFLSLLLPLLITQLTQALTYRGADFSSLAILESSGRTYQDSSSSSKRPFETILSSHGTNLARIRIWTGQEY
SLDYGLRLARRAVNAGMNVMVDLHYSDTWADPAHQSIPSSWPRDLSGLNTKIFTYTRDIVNAFANQGTPMQFIQI
GNEINDGFLWPTAQISKSGFSPPSQLLHSAANGVRSATGGSSIKIMVHVSNGWDSGLQNFFYDGIFRPGEFAMGD
FDLFGVSFYPFYGREATFERLRSTLTGLVNKYNKDVMVVETDWPAIGSCPGVSLSENSISISTNGQIQWVNGIKN
VLNQLPGGHGIGFVYWEPGWIGNAGLGSSCSDNLLVDNQGVSRASMSMFSN*
Coding >AgabiH97|110430
ATGATATTATTCTCCTTCCTCTCCCTCCTCCTCCCACTCCTCATCACTCAATTAACTCAAGCTCTAACCTACCGC
GGTGCCGATTTCTCCTCCCTCGCCATTCTCGAATCTTCCGGTCGCACCTACCAAGATTCTTCTTCCTCTTCTAAA
CGCCCTTTCGAAACTATTCTAAGTTCTCATGGAACCAATCTTGCTAGGATACGAATTTGGACGGGACAGGAATAT
AGTTTGGATTATGGATTGAGGTTGGCGAGGAGGGCTGTTAATGCTGGGATGAATGTTATGGTGGATTTGCATTAC
AGTGATACTTGGGCTGATCCGGCACATCAATCTATTCCATCTTCGTGGCCGAGAGATCTCTCGGGTTTGAACACG
AAAATCTTCACTTACACCCGCGATATCGTCAACGCATTCGCCAACCAAGGAACCCCAATGCAATTCATCCAAATC
GGAAACGAAATCAACGACGGCTTCCTCTGGCCCACCGCCCAAATATCCAAATCCGGATTCTCTCCCCCCTCCCAA
CTTCTTCATTCAGCTGCCAATGGTGTACGTTCAGCCACAGGAGGATCTTCCATCAAAATCATGGTACATGTATCC
AATGGTTGGGATTCCGGTTTACAAAATTTCTTTTATGATGGTATTTTTCGACCTGGAGAATTTGCGATGGGGGAT
TTTGATTTGTTTGGGGTTTCGTTTTATCCGTTTTATGGGAGGGAGGCGACGTTTGAGAGGTTGAGAAGTACGTTG
ACGGGGTTGGTTAATAAATACAATAAGGATGTTATGGTGGTTGAAACGGATTGGCCAGCTATAGGTTCATGTCCT
GGTGTATCTCTCAGCGAAAACTCTATTTCTATCTCCACAAACGGTCAAATTCAATGGGTGAATGGAATCAAAAAC
GTTTTGAATCAATTACCTGGTGGACATGGTATTGGATTTGTGTATTGGGAACCTGGATGGATTGGGAATGCGGGG
TTGGGATCGAGTTGTAGTGATAATTTGTTGGTTGATAATCAAGGCGTTTCGAGGGCTAGCATGTCTATGTTTTCT
AACTGA
Transcript >AgabiH97|110430
ATGATATTATTCTCCTTCCTCTCCCTCCTCCTCCCACTCCTCATCACTCAATTAACTCAAGCTCTAACCTACCGC
GGTGCCGATTTCTCCTCCCTCGCCATTCTCGAATCTTCCGGTCGCACCTACCAAGATTCTTCTTCCTCTTCTAAA
CGCCCTTTCGAAACTATTCTAAGTTCTCATGGAACCAATCTTGCTAGGATACGAATTTGGACGGGACAGGAATAT
AGTTTGGATTATGGATTGAGGTTGGCGAGGAGGGCTGTTAATGCTGGGATGAATGTTATGGTGGATTTGCATTAC
AGTGATACTTGGGCTGATCCGGCACATCAATCTATTCCATCTTCGTGGCCGAGAGATCTCTCGGGTTTGAACACG
AAAATCTTCACTTACACCCGCGATATCGTCAACGCATTCGCCAACCAAGGAACCCCAATGCAATTCATCCAAATC
GGAAACGAAATCAACGACGGCTTCCTCTGGCCCACCGCCCAAATATCCAAATCCGGATTCTCTCCCCCCTCCCAA
CTTCTTCATTCAGCTGCCAATGGTGTACGTTCAGCCACAGGAGGATCTTCCATCAAAATCATGGTACATGTATCC
AATGGTTGGGATTCCGGTTTACAAAATTTCTTTTATGATGGTATTTTTCGACCTGGAGAATTTGCGATGGGGGAT
TTTGATTTGTTTGGGGTTTCGTTTTATCCGTTTTATGGGAGGGAGGCGACGTTTGAGAGGTTGAGAAGTACGTTG
ACGGGGTTGGTTAATAAATACAATAAGGATGTTATGGTGGTTGAAACGGATTGGCCAGCTATAGGTTCATGTCCT
GGTGTATCTCTCAGCGAAAACTCTATTTCTATCTCCACAAACGGTCAAATTCAATGGGTGAATGGAATCAAAAAC
GTTTTGAATCAATTACCTGGTGGACATGGTATTGGATTTGTGTATTGGGAACCTGGATGGATTGGGAATGCGGGG
TTGGGATCGAGTTGTAGTGATAATTTGTTGGTTGATAATCAAGGCGTTTCGAGGGCTAGCATGTCTATGTTTTCT
AACTGA
Gene >AgabiH97|110430
ATGATATTATTCTCCTTCCTCTCCCTCCTCCTCCCACTCCTCATCACTCAATTAACTCAAGCTCTAACCTACCGC
GGTGCCGATTTCTCCTCCCTCGCCATTCTCGAATCTTCCGGTCGCACCTACCAAGATTCTTCTTCCTCTTCTAAA
CGCCCTTTCGAAACTATTCTAAGTTCTCATGGAACCAATCTTGCTAGGATACGAATTTGGACGGGACAGGAATAT
AGTTTGGATTATGGATTGAGGTTGGCGAGGAGGGCTGTTAATGCTGGGATGAATGTTATGGTGGATTTGCATTAC
AGTGATACTTGTGAGTTTTTTTGACTTTCGTTTTTTTTTTGTTCGGTTTGTTGATTGTGGGTGGATTTTGATTGT
AGGGGCTGATCCGGCACATCAATCTATTCCATCTTCGTGGCCGAGAGATCTCTCGGGTTTGAACACGAAAATCTT
CACGTAAGTTTTCATCATCACCTATCCCTTTTTCATTACACTTCCTCCTTCATAAGTTACACCCGCGATATCGTC
AACGCATTCGCCAACCAAGGAACCCCAATGCAATTCATCCAAGTACATAACCAAAACTCCTTTACTTCTCTTCCC
TAACTCACACATACAGATCGGAAACGAAATCAACGACGGCTTCCTCTGGCCCACCGCCCAAATATCCAAATCCGG
ATTCTCTCCCCCCTCCCAACTTCTTCATTCAGCTGCCAATGGTGTACGTTCAGCCACAGGAGGATCTTCCATCAA
AATCATGGTACATGTATCCAATGGTTGGGATTCCGGTTTACAAAATTTCTTTTATGATGGTATTTTTCGACCTGG
AGAATTTGCGATGGGGGATTTTGATTTGTTTGGGGTTTCGTTTTATCCGTTTTATGGGAGGGAGGCGACGTTTGA
GAGGTTGAGAAGTACGTTGACGGGGTTGGTTAATAAATACAATAAGGTTCGGGAAATTTATCTGATATTTTTTTA
ACTTCTTAATGATTTATTTATTGATAAGGATGTTATGGTGGTTGAAACGGATTGGCCAGCTATAGGTTCATGTCC
TGGTGTATCTCTCAGCGAAAACTCTATTTCTATCTCCACAAACGGTCAAATTCAATGGGTGAATGGAATCAAAAA
CGTTTTGAATCAATTACCTGGTGGACATGGTATTGGATTTGTGTATTGGGAACCTGGATGGATTGGGAATGCGGG
GTTGGGATCGAGTTGTAGTGTAAGTGTTTATTATTCGATTCGATTTAATTTTACTGATATTTTTTGGAAGGATAA
TTTGTTGGTTGATAATCAAGGCGTTTCGAGGGCTAGCATGTCTATGTTTTCTAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail