Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|110390
Gene name
Locationscaffold_8:1106423..1108974
Strand-
Gene length (bp)2551
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01532 Glyco_hydro_47 Glycosyl hydrolase family 47 6.3E-130 48 498

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CP08|MNS1B_ASPCL Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mns1B PE=3 SV=1 35 498 2.0E-102
sp|Q5BF93|MNS1B_EMENI Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mns1B PE=2 SV=2 42 502 4.0E-98
sp|Q4WRZ5|MNS1B_ASPFU Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mns1B PE=3 SV=1 10 475 4.0E-97
sp|B0XMT4|MNS1B_ASPFC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mns1B PE=3 SV=1 10 475 4.0E-97
sp|Q0D076|MNS1B_ASPTN Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mns1B PE=3 SV=1 44 498 4.0E-97
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CP08|MNS1B_ASPCL Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mns1B PE=3 SV=1 35 498 2.0E-102
sp|Q5BF93|MNS1B_EMENI Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mns1B PE=2 SV=2 42 502 4.0E-98
sp|Q4WRZ5|MNS1B_ASPFU Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mns1B PE=3 SV=1 10 475 4.0E-97
sp|B0XMT4|MNS1B_ASPFC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mns1B PE=3 SV=1 10 475 4.0E-97
sp|Q0D076|MNS1B_ASPTN Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mns1B PE=3 SV=1 44 498 4.0E-97
sp|A1D1W1|MNS1B_NEOFI Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mns1B PE=3 SV=1 10 475 8.0E-97
sp|Q12563|MNS1B_ASPPH Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis GN=mns1B PE=2 SV=1 8 501 3.0E-96
sp|A2QAS2|MNS1B_ASPNC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mns1B PE=3 SV=1 9 501 3.0E-94
sp|Q2ULB2|MNS1B_ASPOR Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mns1B PE=1 SV=1 44 498 2.0E-93
sp|B8N417|MNS1B_ASPFN Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mns1B PE=3 SV=2 44 498 2.0E-93
sp|P31723|MAN12_PENCI Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum GN=MSDC PE=1 SV=2 34 498 6.0E-92
sp|E9CXX8|MNS1B_COCPS Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CPSG_02648 PE=1 SV=1 44 498 2.0E-91
sp|D4AV26|MNS1B_ARTBC Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00035 PE=1 SV=1 44 498 4.0E-89
sp|Q9C512|MNS1_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana GN=MNS1 PE=1 SV=1 41 498 2.0E-63
sp|Q8H116|MNS2_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana GN=MNS2 PE=1 SV=1 44 500 7.0E-62
sp|Q18788|MAN12_CAEEL Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5 OS=Caenorhabditis elegans GN=C52E4.5 PE=1 SV=1 41 500 1.0E-61
sp|P53624|MA1A1_DROME Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster GN=alpha-Man-Ia PE=1 SV=2 20 505 5.0E-59
sp|Q9UKM7|MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens GN=MAN1B1 PE=1 SV=2 44 498 2.0E-58
sp|Q93Y37|MNS3_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana GN=MNS3 PE=2 SV=1 38 498 4.0E-57
sp|Q9NR34|MA1C1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens GN=MAN1C1 PE=1 SV=1 41 496 2.0E-54
sp|P33908|MA1A1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Homo sapiens GN=MAN1A1 PE=1 SV=3 41 498 3.0E-54
sp|O02773|MA1A1_PIG Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Sus scrofa GN=MAN1A1 PE=1 SV=1 20 498 3.0E-54
sp|P45701|MA1A1_RABIT Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (Fragment) OS=Oryctolagus cuniculus GN=MAN1A1 PE=1 SV=1 41 503 3.0E-54
sp|B2GUY0|MA1B1_RAT Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus GN=Man1b1 PE=2 SV=2 44 498 7.0E-54
sp|P45700|MA1A1_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus GN=Man1a1 PE=1 SV=1 25 498 8.0E-54
sp|P39098|MA1A2_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus GN=Man1a2 PE=1 SV=1 41 496 3.0E-53
sp|A2AJ15|MA1B1_MOUSE Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus GN=Man1b1 PE=1 SV=1 44 498 4.0E-53
sp|O60476|MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens GN=MAN1A2 PE=1 SV=1 41 498 4.0E-53
sp|Q8J0Q0|MNS1_CANAX Mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Candida albicans GN=MNS1 PE=3 SV=2 41 496 1.0E-50
sp|Q9P7C3|MNS1_SCHPO Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P5.01c PE=1 SV=2 44 496 1.0E-46
sp|P32906|MNS1_YEAST Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNS1 PE=1 SV=1 37 496 5.0E-44
sp|Q9BV94|EDEM2_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens GN=EDEM2 PE=1 SV=2 13 496 5.0E-37
sp|Q925U4|EDEM1_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus GN=Edem1 PE=1 SV=1 34 498 7.0E-35
sp|Q92611|EDEM1_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens GN=EDEM1 PE=1 SV=1 34 494 4.0E-34
sp|Q9FG93|MNS4_ARATH Probable alpha-mannosidase I MNS4 OS=Arabidopsis thaliana GN=MNS4 PE=2 SV=1 34 498 8.0E-34
sp|O94726|MNL1_SCHPO ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mnl1 PE=3 SV=2 40 504 2.0E-33
sp|P38888|MNL1_YEAST ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNL1 PE=1 SV=1 41 499 6.0E-27
sp|Q6GQB9|EDEM3_XENLA ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Xenopus laevis GN=edem3 PE=2 SV=2 35 544 2.0E-25
sp|Q9BZQ6|EDEM3_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Homo sapiens GN=EDEM3 PE=1 SV=2 42 544 1.0E-24
sp|Q2HXL6|EDEM3_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Mus musculus GN=Edem3 PE=1 SV=2 1 544 1.0E-22
sp|Q9SXC9|MNS5_ARATH Probable alpha-mannosidase I MNS5 OS=Arabidopsis thaliana GN=MNS5 PE=2 SV=1 40 262 7.0E-17
sp|Q9SXC9|MNS5_ARATH Probable alpha-mannosidase I MNS5 OS=Arabidopsis thaliana GN=MNS5 PE=2 SV=1 394 498 2.0E-16
sp|Q12205|MNL2_YEAST Putative endoplasmic reticulum mannosidase MNL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNL2 PE=1 SV=1 406 497 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004571 mannosyl-oligosaccharide 1,2-alpha-mannosidase activity Yes
GO:0016020 membrane Yes
GO:0005509 calcium ion binding Yes
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0110165 cellular anatomical entity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0005575 cellular_component No
GO:0005488 binding No
GO:0015923 mannosidase activity No
GO:0015924 mannosyl-oligosaccharide mannosidase activity No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0004559 alpha-mannosidase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|110390
MVHSRSLLTTVFIASVSSLLASAANVQKPDLTVPDSAAGIRDDVKDVFVKSYRAYVKQAFGHDDLAPLSGGFVDR
RNGWGATIVDAMSTMNVMDLDQEFSEAVDFTSGIDFTRSKTPDTVSVFESTIRYVGGLLSAYELSDRTFPVLLQK
AKELADKLAFAWVEDNDVPFGHIDFNTNTPAVENTNIAEAGTLLLEWSTLSKYTGNDTYRQLAERSSRRIATNPA
PLPGLAAQGLDPRSGSPVGGYVSWGGGSDSYFEYLIKYARLNNTADSLFADTWKLAVDSSIRTLLKNTNTETVQT
YLADYNSNKQIVHISSHLACFHGGNWLLGGQLLDNQTIVDVALKLVDSCWNTYSSTATGIGPEVFGFASDDGDFT
GQAAPTAAQKAFYQLHGFYPIISYYDMRPEVLESNFYAWRVTGDTKYLDRAASALRSFATYLAVNDAYAPIQDVN
DPNSMKIDDLESFWFAETLKYLYLTFDDPSRFSLDEYIFTTEAHPLRIPTTKETYGSPLDPSPETSDFVPSMTES
PLPVYSNNPSFPAHIPEPL*
Coding >AgabiH97|110390
ATGGTACACTCACGCTCTCTACTTACTACAGTCTTTATCGCTAGTGTTTCCTCGTTGCTCGCCTCGGCTGCCAAT
GTCCAGAAGCCAGACCTGACAGTACCTGACAGCGCTGCGGGCATTCGGGATGATGTCAAGGACGTTTTTGTGAAG
AGTTATAGAGCATATGTGAAACAAGCTTTCGGTCATGATGACCTCGCGCCACTGTCTGGAGGTTTCGTTGACAGA
CGTAATGGATGGGGTGCTACTATTGTGGATGCAATGTCTACTATGAATGTTATGGATTTGGACCAAGAATTTTCT
GAGGCTGTCGATTTTACTTCTGGGATCGACTTCACCAGGTCCAAAACACCTGACACTGTTAGTGTGTTCGAGTCG
ACCATTCGGTATGTCGGAGGCTTGTTGAGCGCCTACGAACTCAGCGATCGGACGTTCCCTGTTCTTCTTCAAAAG
GCCAAGGAGCTCGCGGACAAGCTGGCCTTCGCTTGGGTCGAGGACAATGATGTTCCGTTTGGACATATTGATTTC
AATACGAATACTCCGGCAGTCGAAAATACCAACATTGCCGAAGCAGGAACTTTACTGCTTGAATGGTCTACCCTG
AGCAAGTACACGGGAAACGACACATATCGTCAGCTTGCAGAAAGATCTTCGCGTCGCATCGCTACCAATCCTGCT
CCATTGCCAGGCCTTGCGGCACAAGGCCTTGACCCAAGGAGCGGTTCGCCGGTCGGCGGCTATGTTAGCTGGGGC
GGAGGTTCCGATAGCTACTTTGAGTACCTCATCAAATATGCTCGTCTCAACAATACCGCCGACTCGCTATTTGCT
GACACGTGGAAGCTTGCTGTTGATTCGTCCATCCGCACCTTGCTCAAGAATACCAACACGGAGACAGTTCAAACC
TACCTCGCTGATTACAACTCCAACAAGCAGATTGTTCACATCAGTTCTCATTTGGCGTGTTTCCACGGAGGAAAC
TGGTTATTGGGTGGTCAGTTACTCGACAACCAAACAATCGTCGACGTTGCTTTGAAACTCGTCGATTCCTGTTGG
AATACCTATAGCAGCACTGCCACTGGTATTGGACCGGAAGTCTTTGGTTTTGCCTCTGACGACGGTGATTTCACT
GGTCAAGCCGCCCCGACAGCAGCACAAAAAGCATTCTACCAGCTCCACGGATTTTATCCGATAATTTCGTACTAT
GATATGCGCCCAGAAGTTTTGGAGTCAAACTTTTATGCGTGGAGAGTTACAGGTGACACGAAATACCTCGATCGT
GCTGCTAGTGCCCTTCGCAGCTTTGCGACATACCTTGCAGTCAACGATGCGTATGCTCCAATTCAGGATGTGAAC
GACCCTAATTCCATGAAAATCGATGACTTGGAGAGTTTCTGGTTCGCCGAGACACTGAAATACCTTTACCTCACC
TTTGATGACCCTTCCCGCTTCAGCTTGGATGAATACATCTTCACCACCGAGGCTCATCCTCTCAGAATCCCTACT
ACCAAGGAGACATATGGATCGCCTCTTGACCCTTCTCCGGAGACTTCAGATTTCGTGCCGAGTATGACTGAAAGT
CCTCTACCGGTTTACAGCAACAATCCTTCATTCCCCGCCCACATTCCCGAGCCCCTCTGA
Transcript >AgabiH97|110390
ATGGTACACTCACGCTCTCTACTTACTACAGTCTTTATCGCTAGTGTTTCCTCGTTGCTCGCCTCGGCTGCCAAT
GTCCAGAAGCCAGACCTGACAGTACCTGACAGCGCTGCGGGCATTCGGGATGATGTCAAGGACGTTTTTGTGAAG
AGTTATAGAGCATATGTGAAACAAGCTTTCGGTCATGATGACCTCGCGCCACTGTCTGGAGGTTTCGTTGACAGA
CGTAATGGATGGGGTGCTACTATTGTGGATGCAATGTCTACTATGAATGTTATGGATTTGGACCAAGAATTTTCT
GAGGCTGTCGATTTTACTTCTGGGATCGACTTCACCAGGTCCAAAACACCTGACACTGTTAGTGTGTTCGAGTCG
ACCATTCGGTATGTCGGAGGCTTGTTGAGCGCCTACGAACTCAGCGATCGGACGTTCCCTGTTCTTCTTCAAAAG
GCCAAGGAGCTCGCGGACAAGCTGGCCTTCGCTTGGGTCGAGGACAATGATGTTCCGTTTGGACATATTGATTTC
AATACGAATACTCCGGCAGTCGAAAATACCAACATTGCCGAAGCAGGAACTTTACTGCTTGAATGGTCTACCCTG
AGCAAGTACACGGGAAACGACACATATCGTCAGCTTGCAGAAAGATCTTCGCGTCGCATCGCTACCAATCCTGCT
CCATTGCCAGGCCTTGCGGCACAAGGCCTTGACCCAAGGAGCGGTTCGCCGGTCGGCGGCTATGTTAGCTGGGGC
GGAGGTTCCGATAGCTACTTTGAGTACCTCATCAAATATGCTCGTCTCAACAATACCGCCGACTCGCTATTTGCT
GACACGTGGAAGCTTGCTGTTGATTCGTCCATCCGCACCTTGCTCAAGAATACCAACACGGAGACAGTTCAAACC
TACCTCGCTGATTACAACTCCAACAAGCAGATTGTTCACATCAGTTCTCATTTGGCGTGTTTCCACGGAGGAAAC
TGGTTATTGGGTGGTCAGTTACTCGACAACCAAACAATCGTCGACGTTGCTTTGAAACTCGTCGATTCCTGTTGG
AATACCTATAGCAGCACTGCCACTGGTATTGGACCGGAAGTCTTTGGTTTTGCCTCTGACGACGGTGATTTCACT
GGTCAAGCCGCCCCGACAGCAGCACAAAAAGCATTCTACCAGCTCCACGGATTTTATCCGATAATTTCGTACTAT
GATATGCGCCCAGAAGTTTTGGAGTCAAACTTTTATGCGTGGAGAGTTACAGGTGACACGAAATACCTCGATCGT
GCTGCTAGTGCCCTTCGCAGCTTTGCGACATACCTTGCAGTCAACGATGCGTATGCTCCAATTCAGGATGTGAAC
GACCCTAATTCCATGAAAATCGATGACTTGGAGAGTTTCTGGTTCGCCGAGACACTGAAATACCTTTACCTCACC
TTTGATGACCCTTCCCGCTTCAGCTTGGATGAATACATCTTCACCACCGAGGCTCATCCTCTCAGAATCCCTACT
ACCAAGGAGACATATGGATCGCCTCTTGACCCTTCTCCGGAGACTTCAGATTTCGTGCCGAGTATGACTGAAAGT
CCTCTACCGGTTTACAGCAACAATCCTTCATTCCCCGCCCACATTCCCGAGCCCCTCTGA
Gene >AgabiH97|110390
ATGGTACACTCACGCTCTCTACTTACTACAGTCTTTATCGCTAGTGTTTCCTCGTTGCTCGCCTCGGCTGCCAAT
GTCCAGAAGCCAGACCTGACAGTACCTGACAGCGCTGCGGGCATTCGGGATGATGTCAAGGACGTTTTTGTGAAG
AGTTATAGAGCATATGTGTAGGTTTGCATGCGCGTGTAATTCGGTTTAATGTGATTGGTTGCGTGTAGGAAACAA
GCTTTCGGTCATGATGACCTCGCGCCACTGTCTGGAGGTAAGGTTTTTTTTGTTGGCTGCACTACATAGCGAGTT
CTAAAGTTCCCTTAATACGCTTCAGGTTTCGTTGACAGACGTAATGGATGGGGTAAGCATGACCCTCTTGATTCA
ATGCTTTTCTCTAATGATAGATGTTTTGTAAGGTGCTACTATTGTGGATGCAATGTCTACTATGGTGGGTTGATT
TGACTTGTGGGTATATGCTACCATGCTCATATTCCACGTAGAATGTTATGGATTTGGACGTTAGTTTTGGACTTC
CTGTTAAGGGTTGACAAGTCTAATTATTTCTTCAGCAAGAATTTTCTGAGGCTGTCGATTTTACTTCTGGGATCG
ACTTCACCAGGTCCAAAACACCTGACACTGTTAGGTCAGTCGTCGTCTATCAATCGATTTCATTGTATTAATCCC
GGACTCATTCAGTGTGTTCGAGTCGACCATTCGGTATGTCGGAGGCTTGTTGAGCGCCTACGAACTCAGCGATCG
GACGTTCCCTGTTCTTCTTCAAAAGGCCAAGGAGCTCGCGGACAAGCTGGCCTTCGCTTGGGTCGAGGCACGATT
GATACCTTCTACTTTGCTGCATCAATTTCTCAAGTTATTTGATAGGACAATGATGTTCCGTTTGGACATATTGAT
TTCAATACGAATACTCCGGCAGTCGAAAATGTTGGTTCTGATTTTTGCCTTCCATTCCCTTTCTGATTTTGGTAT
ATCCAGACCAACATTGCCGAAGCAGGAACTGTAAGTTTCCAGTCCTTACTGCTTACCTTTCTAAGTTCTACTCCA
GTTACTGCTTGAATGGTCTACCCTGAGCAAGTACACGGGAAACGACACATATCGTCAGCTTGCAGAAAGATCTTC
GCGTCGCATCGCTACCAATGTAAGTGCCACGTATTTGGATTTGCTGGAACACAAAGGCTAACCTTCAACGAAAGC
CTGCTCCATTGCCAGGTGGGTTATTACTCTTTTAAATTCATTGTACAGTGAACTGACGTTGTGCAGGCCTTGCGG
CACAAGGCCTTGACCCAAGGAGCGGTTCGCCGGTCGGCGGCTATGTTGTACGTCCCATTGGCTTTTGCAGTTTCA
TCTTTTGCTTATGGAATAGAGCTGGGGCGGAGGTTCCGATAGCTACTTTGAGTACCTCATCAAATATGCTCGTCT
CAACAATACCGCCGACTCGCTATTTGCTGACACGTGGAAGCTTGCTGTTGATTCGTCCATCCGCACCTTGCTCAA
GGTCAGGATAATTGCTGCATTATCGAAAATTTAGTATCACCTCATACGTCGTGGCAGAATACCAACACGGAGACA
GTTCAAACCTACCTCGCTGATTACAACTCCAACAAGCAGATTGTTCACATCAGTTCTCATTTGGCGTGTTTCCAC
GGAGGAAACTGGTTATTGGGTAAATGGTCATTGTTATCCGTGCATGAATTTCCATCCAATTCCTTGTTATTAAGG
TGGTCAGTTACTCGACAACCAAACAATCGTCGACGTTGCTTTGAAACTCGTCGATTCCTGTTGGAATACCTATAG
CAGCACTGCGTGAGTTGCATATCTTACACTTCTTTATATCTCTCTCTGTCAACTCATACGTCGGTGATAGCACTG
GTATTGGACCGGAAGTCTTTGGTTTTGCCTCTGACGACGGTGATTTCACTGGTCAAGCCGCCCCGACAGCAGCAC
AAAAAGCATTCTACCAGCTCCACGGATTTTATCCGATAATTTCGTACTATGATATGCGCCCAGAAGTTTTGGAGT
CAAACTTTTATGCGTGGAGAGTTACAGGTGACACGAAATACCTCGATCGTGCTGCTAGTGCCCTTCGCAGCTTTG
CGACATACCTTGCAGTCAACGATGCGTATGCTCCAATTCAGGATGTGAACGACCCTAATTCCATGAAAATCGATG
ACTTGGAGAGTTTCTGGTTCGCCGAGACACTGAAATACCTGTACGTGACTTCCTCGATGCTTAGAGGCCTAGTCT
GATGTCGTCTTCGTTTCTAGTTACCTCACCTTTGATGACCCTTCCCGCTTCAGCTTGGATGAATGTAAGCTGATT
TCATGAGTTCAATCGAATATGCTCAATAAACTCTTTACCTTACTCATTAGACATCTTCACCACCGAGGCTCATCC
TCTCAGAATCCCTACTACCAAGGAGACATATGGATCGCCTCTTGACCCTTCTCCGGAGACTTCAGATTTCGTGCC
GAGTATGACTGAAAGTCCTCTACCGGTTTACAGCAACAATCCTTCATTCCCCGCCCACATTCCCGAGCCCCTCTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail