Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|110340
Gene name
Locationscaffold_8:1089569..1090514
Strand-
Gene length (bp)945
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05817 Ribophorin_II Oligosaccharyltransferase subunit Ribophorin II 1.0E-34 20 269

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P91390|RPN2_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Caenorhabditis elegans GN=ostd-1 PE=3 SV=1 31 271 1.0E-16
sp|Q9DBG6|RPN2_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Mus musculus GN=Rpn2 PE=1 SV=1 47 271 1.0E-13
sp|P25235|RPN2_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Rattus norvegicus GN=Rpn2 PE=2 SV=2 47 271 2.0E-13
sp|P04844|RPN2_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens GN=RPN2 PE=1 SV=3 47 271 4.0E-13
sp|Q5RBM1|RPN2_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Pongo abelii GN=RPN2 PE=2 SV=1 47 271 5.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P91390|RPN2_CAEEL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Caenorhabditis elegans GN=ostd-1 PE=3 SV=1 31 271 1.0E-16
sp|Q9DBG6|RPN2_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Mus musculus GN=Rpn2 PE=1 SV=1 47 271 1.0E-13
sp|P25235|RPN2_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Rattus norvegicus GN=Rpn2 PE=2 SV=2 47 271 2.0E-13
sp|P04844|RPN2_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens GN=RPN2 PE=1 SV=3 47 271 4.0E-13
sp|Q5RBM1|RPN2_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Pongo abelii GN=RPN2 PE=2 SV=1 47 271 5.0E-13
sp|Q3SZI6|RPN2_BOVIN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Bos taurus GN=RPN2 PE=2 SV=1 47 271 9.0E-13
sp|Q9GL01|RPN2_PIG Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Sus scrofa GN=RPN2 PE=2 SV=1 47 271 1.0E-12
sp|Q93Z16|RPN2_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Arabidopsis thaliana GN=RPN2 PE=2 SV=1 20 268 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008250 oligosaccharyltransferase complex Yes
GO:0006487 protein N-linked glycosylation Yes
GO:0016021 integral component of membrane Yes
GO:0043413 macromolecule glycosylation No
GO:0110165 cellular anatomical entity No
GO:1990234 transferase complex No
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0098796 membrane protein complex No
GO:0019538 protein metabolic process No
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0006486 protein glycosylation No
GO:0031224 intrinsic component of membrane No
GO:0043170 macromolecule metabolic process No
GO:1902494 catalytic complex No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0032991 protein-containing complex No
GO:0044238 primary metabolic process No
GO:0070085 glycosylation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 185 207 22
2 214 236 22
3 246 268 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|110340
MHVFVASLLLLVASVHAKILTLQSPRFVVLDSQGQQSRSEPISLTQKSRNPVFLNATDTLKVTFQVVDKESGEGT
QPHQTFLRFYDATTDEEGIQPIRVTQGGKAKLELNMARPPLSLPPTGDAPLQVTLYIGQPNFSPIAVELFDLHVP
HSQPPPAHPDEASFHLLPEIHHIFRPDQKLPYKLVSAVFSGLVIAPWFLLVGLWSQVSPRLTHLFSPNVLPFILS
LGAYEFLVFYYWVDLKLGQVLLYGGVLAIINLFTGKHALSSIAKRRLNKN*
Coding >AgabiH97|110340
ATGCACGTCTTCGTCGCGTCGCTGCTTCTCCTCGTTGCTTCTGTTCACGCGAAAATCCTTACACTTCAATCTCCG
CGCTTCGTCGTACTTGATTCGCAGGGACAGCAGTCCCGTTCAGAGCCCATCTCTCTTACCCAGAAATCCAGAAAT
CCAGTGTTTCTGAATGCCACAGATACTCTCAAGGTCACCTTCCAAGTAGTTGACAAAGAGTCTGGCGAAGGGACA
CAACCACACCAAACTTTTCTTCGTTTCTATGATGCCACGACGGACGAAGAGGGTATCCAACCCATTCGTGTCACC
CAAGGCGGCAAGGCTAAACTTGAGCTAAACATGGCCCGCCCTCCTCTCAGCTTACCACCGACTGGCGACGCTCCA
TTGCAGGTGACGCTGTATATCGGACAACCCAACTTCTCTCCTATTGCCGTCGAGTTATTCGACCTCCATGTCCCA
CATTCCCAGCCTCCTCCCGCGCATCCCGACGAAGCTTCCTTCCATCTACTCCCGGAAATTCATCATATCTTCAGG
CCTGACCAGAAACTGCCGTACAAGCTTGTTTCAGCTGTATTCTCCGGCCTGGTTATCGCACCCTGGTTCCTCCTT
GTCGGTCTCTGGTCCCAGGTTTCTCCTCGTCTCACCCATTTATTCTCGCCCAATGTCCTTCCTTTCATCCTCAGT
CTTGGCGCTTATGAATTTCTCGTATTTTATTACTGGGTTGACCTCAAACTTGGCCAAGTCCTCCTTTACGGCGGC
GTCCTTGCTATCATCAATCTCTTCACTGGCAAACATGCTCTTAGTAGCATCGCCAAGCGACGATTGAATAAAAAT
TAG
Transcript >AgabiH97|110340
ATGCACGTCTTCGTCGCGTCGCTGCTTCTCCTCGTTGCTTCTGTTCACGCGAAAATCCTTACACTTCAATCTCCG
CGCTTCGTCGTACTTGATTCGCAGGGACAGCAGTCCCGTTCAGAGCCCATCTCTCTTACCCAGAAATCCAGAAAT
CCAGTGTTTCTGAATGCCACAGATACTCTCAAGGTCACCTTCCAAGTAGTTGACAAAGAGTCTGGCGAAGGGACA
CAACCACACCAAACTTTTCTTCGTTTCTATGATGCCACGACGGACGAAGAGGGTATCCAACCCATTCGTGTCACC
CAAGGCGGCAAGGCTAAACTTGAGCTAAACATGGCCCGCCCTCCTCTCAGCTTACCACCGACTGGCGACGCTCCA
TTGCAGGTGACGCTGTATATCGGACAACCCAACTTCTCTCCTATTGCCGTCGAGTTATTCGACCTCCATGTCCCA
CATTCCCAGCCTCCTCCCGCGCATCCCGACGAAGCTTCCTTCCATCTACTCCCGGAAATTCATCATATCTTCAGG
CCTGACCAGAAACTGCCGTACAAGCTTGTTTCAGCTGTATTCTCCGGCCTGGTTATCGCACCCTGGTTCCTCCTT
GTCGGTCTCTGGTCCCAGGTTTCTCCTCGTCTCACCCATTTATTCTCGCCCAATGTCCTTCCTTTCATCCTCAGT
CTTGGCGCTTATGAATTTCTCGTATTTTATTACTGGGTTGACCTCAAACTTGGCCAAGTCCTCCTTTACGGCGGC
GTCCTTGCTATCATCAATCTCTTCACTGGCAAACATGCTCTTAGTAGCATCGCCAAGCGACGATTGAATAAAAAT
TAG
Gene >AgabiH97|110340
ATGCACGTCTTCGTCGCGTCGCTGCTTCTCCTCGTTGCTTCTGTTCACGCGAAAATCCTTACACTTCAATCTCCG
CGCTTCGTCGTACTTGATTCGCAGGGACAGCAGTCCCGTTCAGAGCCGTATGTTGCATCTATTGTATATCATTCT
CACCACAATTGGTAAACCAGGCCCACAGCATCTCTCTTACCCAGAAATCCAGAAATCCAGTGTTTCTGAATGCCA
CAGATACTCTCAAGGTCACCTTCCAAGTAGTTGACAAAGAGTCTGGCGAAGGGACACAACCACACCAAACTTTTC
TTCGTTTCTATGATGCCACGACGGACGAAGAGGGTATCCAACCCATTCGTGTCACCCAAGGCGGCAAGGCTAAAC
TTGAGCTAAACATGGCCCGCCCTCCTCTCAGCTTACCACCGACTGGCGACGCTCCATTGCAGGTGACGCTGTATA
TCGGACAACCCAACTTCTCTCCTATTGCCGTCGAGTTATTCGACCTCCATGTCCCACATTCCCAGCCTCCTCCCG
CGCATCCCGACGAAGCTTCCTTCCATCTACTCCCGGAAATTCATCATATCTTCAGGCCTGACCAGAAACTGCCGT
ACAAGCTTGTTTCAGCTGTATTCTCCGGCCTGGTTATCGCACCCTGGTTCCTCCTTGTCGGTCTCGTGCGTTTTG
CTATTCTTATAAATTGCGTTCTTGCTGATAGGATTAATATATTCTTCGCAGTGGTCCCAGGTTTCTCCTCGTCTC
ACCCATTTATTCTCGCCCAATGTCCTTCCTTTCATCCTCAGTCTTGGCGCTTATGAATTTCTCGTATTTTATTAC
TGGGTTGACCTCAAACTTGGCCAAGTCCTCCTTTACGGCGGCGTCCTTGCTATCATCAATCTCTTCACTGGCAAA
CATGCTCTTAGTAGCATCGCCAAGCGACGATTGAATAAAAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail