Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|110290
Gene name
Locationscaffold_8:1069908..1075296
Strand-
Gene length (bp)5388
Transcript length (bp)5133
Coding sequence length (bp)5133
Protein length (aa) 1711

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00412 LIM LIM domain 4.8E-15 1501 1556
PF00412 LIM LIM domain 5.7E-09 1649 1702

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 1500 1699 6.0E-35
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 1500 1699 6.0E-35
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 1500 1699 9.0E-35
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 1500 1699 1.0E-34
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 1500 1699 1.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 1500 1699 6.0E-35
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 1500 1699 6.0E-35
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 1500 1699 9.0E-35
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 1500 1699 1.0E-34
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 1500 1699 1.0E-34
sp|O75112|LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2 1500 1700 5.0E-29
sp|Q9JKS4|LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus GN=Ldb3 PE=1 SV=1 1500 1700 6.0E-29
sp|O74398|YOCC_SCHPO LIM domain-containing protein C4F6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.12 PE=1 SV=1 1501 1707 2.0E-27
sp|Q62920|PDLI5_RAT PDZ and LIM domain protein 5 OS=Rattus norvegicus GN=Pdlim5 PE=1 SV=2 1500 1700 6.0E-27
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 1500 1699 7.0E-27
sp|Q8CI51|PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus GN=Pdlim5 PE=1 SV=4 1500 1700 1.0E-26
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 1500 1699 1.0E-26
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 1500 1699 1.0E-26
sp|Q96HC4|PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens GN=PDLIM5 PE=1 SV=5 1500 1700 1.0E-26
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 1486 1699 1.0E-26
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 1500 1699 2.0E-26
sp|Q6P7E4|PDLI7_DANRE PDZ and LIM domain protein 7 OS=Danio rerio GN=pdlim7 PE=2 SV=1 1500 1699 2.0E-24
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 1501 1700 2.0E-24
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 1501 1699 3.0E-24
sp|P48059|LIMS1_HUMAN LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens GN=LIMS1 PE=1 SV=4 1501 1703 4.0E-24
sp|Q99JW4|LIMS1_MOUSE LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus GN=Lims1 PE=1 SV=3 1501 1703 5.0E-24
sp|Q6INU3|PDLI7_XENLA PDZ and LIM domain protein 7 OS=Xenopus laevis GN=pdlim7 PE=2 SV=1 1500 1699 6.0E-24
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 1501 1699 3.0E-23
sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 1501 1703 1.0E-22
sp|Q3TJD7|PDLI7_MOUSE PDZ and LIM domain protein 7 OS=Mus musculus GN=Pdlim7 PE=1 SV=1 1500 1699 2.0E-22
sp|Q9Z1Z9|PDLI7_RAT PDZ and LIM domain protein 7 OS=Rattus norvegicus GN=Pdlim7 PE=1 SV=1 1500 1699 2.0E-22
sp|Q679P3|PDLI7_CHICK PDZ and LIM domain protein 7 OS=Gallus gallus GN=PDLIM7 PE=1 SV=1 1500 1699 9.0E-22
sp|Q3SX40|PDLI7_BOVIN PDZ and LIM domain protein 7 OS=Bos taurus GN=PDLIM7 PE=2 SV=1 1500 1699 1.0E-21
sp|Q9NR12|PDLI7_HUMAN PDZ and LIM domain protein 7 OS=Homo sapiens GN=PDLIM7 PE=1 SV=1 1500 1699 2.0E-21
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 1501 1708 3.0E-21
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 1501 1699 9.0E-21
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus GN=LIMS2 PE=2 SV=2 1501 1703 9.0E-21
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens GN=LIMS2 PE=1 SV=1 1501 1703 1.0E-20
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 1501 1699 1.0E-20
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 1501 1706 9.0E-20
sp|Q80Y24|PRIC2_MOUSE Prickle-like protein 2 OS=Mus musculus GN=Prickle2 PE=1 SV=3 1474 1700 1.0E-18
sp|Q7Z3G6|PRIC2_HUMAN Prickle-like protein 2 OS=Homo sapiens GN=PRICKLE2 PE=1 SV=2 1474 1700 2.0E-18
sp|A1ZA47|ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster GN=Zasp52 PE=1 SV=2 1500 1699 2.0E-18
sp|A1Z6W3|PRIC1_DROME Protein prickle OS=Drosophila melanogaster GN=pk PE=1 SV=1 1501 1698 4.0E-17
sp|Q292U2|PRIC1_DROPS Protein prickle OS=Drosophila pseudoobscura pseudoobscura GN=pk PE=3 SV=3 1501 1698 3.0E-16
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 1474 1699 4.0E-16
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 1497 1703 5.0E-16
sp|Q62523|ZYX_MOUSE Zyxin OS=Mus musculus GN=Zyx PE=1 SV=2 1501 1641 3.0E-15
sp|Q9U1I1|ESN_DROME Protein espinas OS=Drosophila melanogaster GN=esn PE=2 SV=1 1501 1698 5.0E-15
sp|Q9VY77|AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster GN=jub PE=1 SV=3 1447 1596 8.0E-15
sp|Q15942|ZYX_HUMAN Zyxin OS=Homo sapiens GN=ZYX PE=1 SV=1 1501 1641 1.0E-14
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 1501 1644 5.0E-14
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 1501 1644 5.0E-14
sp|Q55BI0|Y6787_DICDI LIM domain-containing protein DDB_G0271356 OS=Dictyostelium discoideum GN=DDB_G0271356 PE=3 SV=1 1501 1702 5.0E-14
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 1500 1595 6.0E-14
sp|G5E5X0|LIMD1_BOVIN LIM domain-containing protein 1 OS=Bos taurus GN=LIMD1 PE=3 SV=1 1501 1648 6.0E-14
sp|Q292U5|ESN_DROPS Protein espinas OS=Drosophila pseudoobscura pseudoobscura GN=esn PE=3 SV=1 1501 1698 7.0E-14
sp|A5H447|ZYX_XENLA Zyxin OS=Xenopus laevis GN=zyx PE=1 SV=1 1500 1645 8.0E-14
sp|B5DEH0|LIMD1_RAT LIM domain-containing protein 1 OS=Rattus norvegicus GN=Limd1 PE=1 SV=1 1501 1648 1.0E-13
sp|Q80VL3|PRIC3_MOUSE Prickle-like protein 3 OS=Mus musculus GN=Prickle3 PE=1 SV=1 1498 1700 1.0E-13
sp|Q9UGP4|LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens GN=LIMD1 PE=1 SV=1 1501 1648 1.0E-13
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 1501 1644 2.0E-13
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens GN=LIMS2 PE=1 SV=1 1491 1703 2.0E-13
sp|Q9QXD8|LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus GN=Limd1 PE=1 SV=2 1501 1648 2.0E-13
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 1499 1699 2.0E-13
sp|Q96MT3|PRIC1_HUMAN Prickle-like protein 1 OS=Homo sapiens GN=PRICKLE1 PE=1 SV=2 1500 1700 2.0E-13
sp|Q174I2|PRIC1_AEDAE Protein prickle OS=Aedes aegypti GN=pk PE=3 SV=1 1500 1698 3.0E-13
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 1501 1644 4.0E-13
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 1501 1644 5.0E-13
sp|Q3U5C7|PRIC1_MOUSE Prickle-like protein 1 OS=Mus musculus GN=Prickle1 PE=1 SV=1 1500 1700 9.0E-13
sp|Q0VA45|ZYX_XENTR Zyxin OS=Xenopus tropicalis GN=zyx PE=2 SV=1 1500 1645 9.0E-13
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus GN=LIMS2 PE=2 SV=2 1491 1703 1.0E-12
sp|Q7TQJ8|WTIP_MOUSE Wilms tumor protein 1-interacting protein OS=Mus musculus GN=Wtip PE=1 SV=1 1501 1643 1.0E-12
sp|O43900|PRIC3_HUMAN Prickle-like protein 3 OS=Homo sapiens GN=PRICKLE3 PE=1 SV=2 1498 1700 2.0E-12
sp|Q15654|TRIP6_HUMAN Thyroid receptor-interacting protein 6 OS=Homo sapiens GN=TRIP6 PE=1 SV=3 1501 1640 2.0E-12
sp|Q5F464|LPP_CHICK Lipoma-preferred partner homolog OS=Gallus gallus GN=LPP PE=2 SV=1 1501 1641 2.0E-12
sp|Q93052|LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens GN=LPP PE=1 SV=1 1501 1646 3.0E-12
sp|Q9WUH4|FHL1_RAT Four and a half LIM domains protein 1 OS=Rattus norvegicus GN=Fhl1 PE=2 SV=1 1525 1703 3.0E-12
sp|A9LS46|WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis GN=wtip PE=2 SV=1 1501 1643 3.0E-12
sp|P97447|FHL1_MOUSE Four and a half LIM domains protein 1 OS=Mus musculus GN=Fhl1 PE=1 SV=3 1525 1703 3.0E-12
sp|Q9Z1Y4|TRIP6_MOUSE Thyroid receptor-interacting protein 6 OS=Mus musculus GN=Trip6 PE=1 SV=1 1501 1640 4.0E-12
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 1493 1699 4.0E-12
sp|Q5XI07|LPP_RAT Lipoma-preferred partner homolog OS=Rattus norvegicus GN=Lpp PE=1 SV=1 1501 1646 4.0E-12
sp|Q04584|ZYX_CHICK Zyxin OS=Gallus gallus GN=ZYX PE=1 SV=1 1501 1641 5.0E-12
sp|Q91XC0|AJUBA_MOUSE LIM domain-containing protein ajuba OS=Mus musculus GN=Ajuba PE=1 SV=1 1501 1642 6.0E-12
sp|Q5U2Z2|AJUBA_RAT LIM domain-containing protein ajuba OS=Rattus norvegicus GN=Ajuba PE=1 SV=1 1501 1642 6.0E-12
sp|Q8BFW7|LPP_MOUSE Lipoma-preferred partner homolog OS=Mus musculus GN=Lpp PE=1 SV=1 1501 1646 6.0E-12
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 1493 1699 6.0E-12
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 1501 1599 7.0E-12
sp|A6NIX2|WTIP_HUMAN Wilms tumor protein 1-interacting protein OS=Homo sapiens GN=WTIP PE=1 SV=3 1501 1643 7.0E-12
sp|Q96IF1|AJUBA_HUMAN LIM domain-containing protein ajuba OS=Homo sapiens GN=AJUBA PE=1 SV=1 1501 1642 7.0E-12
sp|Q7QJT4|PRIC1_ANOGA Protein prickle OS=Anopheles gambiae GN=pk PE=3 SV=4 1499 1698 7.0E-12
sp|Q71QF9|PRIC1_RAT Prickle-like protein 1 OS=Rattus norvegicus GN=Prickle1 PE=2 SV=2 1500 1700 8.0E-12
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 1465 1644 9.0E-12
sp|Q2IBC3|TES_RHIFE Testin OS=Rhinolophus ferrumequinum GN=TES PE=3 SV=1 1520 1698 9.0E-12
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 1465 1644 1.0E-11
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 1501 1595 1.0E-11
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 1501 1599 1.0E-11
sp|Q3SX26|TRIP6_BOVIN Thyroid receptor-interacting protein 6 OS=Bos taurus GN=TRIP6 PE=2 SV=1 1501 1596 1.0E-11
sp|Q6DIR5|TES_XENTR Testin OS=Xenopus tropicalis GN=tes PE=2 SV=1 1520 1698 1.0E-11
sp|Q14192|FHL2_HUMAN Four and a half LIM domains protein 2 OS=Homo sapiens GN=FHL2 PE=1 SV=3 1525 1703 1.0E-11
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 1498 1644 2.0E-11
sp|Q2QLA1|TES_MONDO Testin OS=Monodelphis domestica GN=TES PE=3 SV=1 1520 1706 2.0E-11
sp|O35115|FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus GN=Fhl2 PE=1 SV=1 1525 1703 2.0E-11
sp|O70433|FHL2_MOUSE Four and a half LIM domains protein 2 OS=Mus musculus GN=Fhl2 PE=1 SV=1 1525 1703 2.0E-11
sp|B7ZUL2|LIMD1_XENTR LIM domain-containing protein 1 OS=Xenopus tropicalis GN=limd1 PE=2 SV=1 1501 1643 3.0E-11
sp|A8DZE6|WTIP_DANRE Wilms tumor protein 1-interacting protein homolog OS=Danio rerio GN=wtip PE=3 SV=1 1501 1647 3.0E-11
sp|Q90WV2|PRI1B_XENLA Prickle-like protein 1-B OS=Xenopus laevis GN=prickle1-b PE=2 SV=2 1500 1700 3.0E-11
sp|Q90Z06|PRI1A_XENLA Prickle-like protein 1-A OS=Xenopus laevis GN=prickle1-a PE=1 SV=1 1501 1698 3.0E-11
sp|Q28FG2|PRIC1_XENTR Prickle-like protein 1 OS=Xenopus tropicalis GN=prickle1 PE=2 SV=1 1500 1700 3.0E-11
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 1501 1595 4.0E-11
sp|Q07DX3|TES_MUNRE Testin OS=Muntiacus reevesi GN=TES PE=3 SV=1 1520 1698 4.0E-11
sp|Q09YK3|TES_MUNMU Testin OS=Muntiacus muntjak GN=TES PE=3 SV=1 1520 1698 4.0E-11
sp|E1BKA3|AJUBA_BOVIN LIM domain-containing protein ajuba OS=Bos taurus GN=AJUBA PE=3 SV=1 1501 1642 4.0E-11
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 1501 1599 5.0E-11
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 1501 1700 5.0E-11
sp|Q5TD97|FHL5_HUMAN Four and a half LIM domains protein 5 OS=Homo sapiens GN=FHL5 PE=1 SV=1 1520 1709 5.0E-11
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 1501 1599 6.0E-11
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 1501 1595 7.0E-11
sp|Q2QLB2|TES_HORSE Testin OS=Equus caballus GN=TES PE=3 SV=1 1520 1698 7.0E-11
sp|Q2YDE9|TES_BOVIN Testin OS=Bos taurus GN=TES PE=2 SV=1 1520 1698 9.0E-11
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 1501 1700 9.0E-11
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 1501 1595 1.0E-10
sp|Q19157|PIN2_CAEEL LIM domain-containing protein pin-2 OS=Caenorhabditis elegans GN=pin-2 PE=2 SV=2 1500 1702 1.0E-10
sp|Q8UVR3|LMX1B_XENLA LIM homeobox transcription factor 1-beta.1 OS=Xenopus laevis GN=lmx1b.1 PE=2 SV=1 1500 1624 1.0E-10
sp|Q108U9|TES_LOXAF Testin OS=Loxodonta africana GN=TES PE=3 SV=1 1520 1698 1.0E-10
sp|A0M8U6|TES_CANLF Testin OS=Canis lupus familiaris GN=TES PE=3 SV=1 1520 1698 1.0E-10
sp|Q09YJ2|TES_SHEEP Testin OS=Ovis aries GN=TES PE=3 SV=1 1520 1698 1.0E-10
sp|A0M8S5|TES_FELCA Testin OS=Felis catus GN=TES PE=3 SV=1 1520 1698 1.0E-10
sp|P53413|LMX1B_CHICK LIM/homeobox protein LMX-1.2 OS=Gallus gallus GN=LMX1B PE=2 SV=2 1500 1624 1.0E-10
sp|Q06BR1|LIMD1_XENLA LIM domain-containing protein 1 OS=Xenopus laevis GN=limd1 PE=1 SV=1 1501 1643 1.0E-10
sp|Q8TE12|LMX1A_HUMAN LIM homeobox transcription factor 1-alpha OS=Homo sapiens GN=LMX1A PE=1 SV=1 1500 1622 1.0E-10
sp|Q07E40|TES_NEONE Testin OS=Neofelis nebulosa GN=TES PE=3 SV=1 1520 1698 2.0E-10
sp|Q2IBH0|TES_EULMM Testin OS=Eulemur macaco macaco GN=TES PE=3 SV=1 1520 1698 2.0E-10
sp|Q7ZXE9|TES_XENLA Testin OS=Xenopus laevis GN=tes PE=2 SV=1 1520 1698 2.0E-10
sp|Q4R7A4|FHL5_MACFA Four and a half LIM domains protein 5 OS=Macaca fascicularis GN=FHL5 PE=2 SV=1 1520 1709 2.0E-10
sp|O88609|LMX1B_MOUSE LIM homeobox transcription factor 1-beta OS=Mus musculus GN=Lmx1b PE=2 SV=3 1500 1624 2.0E-10
sp|O60663|LMX1B_HUMAN LIM homeobox transcription factor 1-beta OS=Homo sapiens GN=LMX1B PE=1 SV=3 1500 1624 2.0E-10
sp|Q60564|LMX1B_MESAU LIM homeobox transcription factor 1-beta (Fragment) OS=Mesocricetus auratus GN=LMX1B PE=2 SV=1 1500 1624 3.0E-10
sp|Q69ZX8|ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus GN=Ablim3 PE=1 SV=2 1489 1699 3.0E-10
sp|Q2QLC3|TES_CALMO Testin OS=Callicebus moloch GN=TES PE=3 SV=1 1520 1698 3.0E-10
sp|Q2LAP6|TES_RAT Testin OS=Rattus norvegicus GN=Tes PE=1 SV=1 1520 1698 3.0E-10
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens GN=ABLIM3 PE=1 SV=3 1492 1699 3.0E-10
sp|Q00PK1|TES_ATEAB Testin OS=Atelerix albiventris GN=TES PE=3 SV=1 1520 1698 3.0E-10
sp|Q07E27|TES_MUSPF Testin OS=Mustela putorius furo GN=TES PE=3 SV=1 1520 1698 4.0E-10
sp|Q09YI0|TES_SAIBB Testin OS=Saimiri boliviensis boliviensis GN=TES PE=3 SV=1 1520 1698 4.0E-10
sp|Q07E51|TES_DASNO Testin OS=Dasypus novemcinctus GN=TES PE=3 SV=1 1520 1698 6.0E-10
sp|Q09YL5|TES_ATEGE Testin OS=Ateles geoffroyi GN=TES PE=3 SV=1 1520 1698 6.0E-10
sp|Q07DW1|TES_AOTNA Testin OS=Aotus nancymaae GN=TES PE=3 SV=1 1520 1698 6.0E-10
sp|Q99JW4|LIMS1_MOUSE LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus GN=Lims1 PE=1 SV=3 1500 1595 7.0E-10
sp|Q09YN8|TES_RABIT Testin OS=Oryctolagus cuniculus GN=TES PE=3 SV=1 1520 1698 7.0E-10
sp|Q2KI95|FHL2_BOVIN Four and a half LIM domains protein 2 OS=Bos taurus GN=FHL2 PE=2 SV=1 1501 1702 7.0E-10
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 1500 1705 8.0E-10
sp|Q2KI95|FHL2_BOVIN Four and a half LIM domains protein 2 OS=Bos taurus GN=FHL2 PE=2 SV=1 1525 1703 8.0E-10
sp|Q2QL92|TES_MICMU Testin OS=Microcebus murinus GN=TES PE=3 SV=1 1520 1698 8.0E-10
sp|Q5PXT2|LMCD1_PIG LIM and cysteine-rich domains protein 1 OS=Sus scrofa GN=LMCD1 PE=2 SV=1 1505 1610 9.0E-10
sp|Q2QLE3|TES_PIG Testin OS=Sus scrofa GN=TES PE=3 SV=1 1520 1698 9.0E-10
sp|Q2QLH9|TES_OTOGA Testin OS=Otolemur garnettii GN=TES PE=3 SV=1 1520 1705 1.0E-09
sp|Q2QLG8|TES_CALJA Testin OS=Callithrix jacchus GN=TES PE=3 SV=1 1520 1698 1.0E-09
sp|A0M8R4|TES_PAPAN Testin OS=Papio anubis GN=TES PE=3 SV=1 1520 1698 1.0E-09
sp|Q2IBA3|TES_CHLAE Testin OS=Chlorocebus aethiops GN=TES PE=3 SV=1 1520 1698 1.0E-09
sp|Q8IR79|LIMK1_DROME LIM domain kinase 1 OS=Drosophila melanogaster GN=LIMK1 PE=1 SV=1 1500 1596 1.0E-09
sp|Q07DZ4|TES_COLGU Testin OS=Colobus guereza GN=TES PE=3 SV=1 1520 1698 1.0E-09
sp|Q07DY3|TES_NOMLE Testin OS=Nomascus leucogenys GN=TES PE=3 SV=1 1520 1698 1.0E-09
sp|Q5RC52|TES_PONAB Testin OS=Pongo abelii GN=TES PE=2 SV=1 1520 1698 1.0E-09
sp|Q2QLF4|TES_PANTR Testin OS=Pan troglodytes GN=TES PE=3 SV=1 1520 1698 1.0E-09
sp|Q9UGI8|TES_HUMAN Testin OS=Homo sapiens GN=TES PE=1 SV=1 1520 1698 1.0E-09
sp|P48059|LIMS1_HUMAN LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens GN=LIMS1 PE=1 SV=4 1500 1595 2.0E-09
sp|P97447|FHL1_MOUSE Four and a half LIM domains protein 1 OS=Mus musculus GN=Fhl1 PE=1 SV=3 1501 1702 2.0E-09
sp|Q90YH9|TES_CHICK Testin OS=Gallus gallus GN=TES PE=2 SV=1 1520 1698 2.0E-09
sp|P47226|TES_MOUSE Testin OS=Mus musculus GN=Tes PE=1 SV=1 1520 1698 2.0E-09
sp|Q17QE2|LMCD1_BOVIN LIM and cysteine-rich domains protein 1 OS=Bos taurus GN=LMCD1 PE=2 SV=1 1505 1595 2.0E-09
sp|Q8VEE1|LMCD1_MOUSE LIM and cysteine-rich domains protein 1 OS=Mus musculus GN=Lmcd1 PE=1 SV=1 1505 1595 2.0E-09
sp|Q3TJD7|PDLI7_MOUSE PDZ and LIM domain protein 7 OS=Mus musculus GN=Pdlim7 PE=1 SV=1 1558 1706 3.0E-09
sp|Q9VY77|AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster GN=jub PE=1 SV=3 1500 1680 3.0E-09
sp|Q9WUH4|FHL1_RAT Four and a half LIM domains protein 1 OS=Rattus norvegicus GN=Fhl1 PE=2 SV=1 1501 1702 3.0E-09
sp|Q68EY3|LHX9_XENLA LIM/homeobox protein Lhx9 OS=Xenopus laevis GN=lhx9 PE=2 SV=1 1500 1618 3.0E-09
sp|Q9NZU5|LMCD1_HUMAN LIM and cysteine-rich domains protein 1 OS=Homo sapiens GN=LMCD1 PE=1 SV=1 1505 1595 3.0E-09
sp|Q9Z1Z9|PDLI7_RAT PDZ and LIM domain protein 7 OS=Rattus norvegicus GN=Pdlim7 PE=1 SV=1 1558 1706 4.0E-09
sp|Q6INU3|PDLI7_XENLA PDZ and LIM domain protein 7 OS=Xenopus laevis GN=pdlim7 PE=2 SV=1 1558 1706 5.0E-09
sp|Q13642|FHL1_HUMAN Four and a half LIM domains protein 1 OS=Homo sapiens GN=FHL1 PE=1 SV=4 1525 1703 5.0E-09
sp|Q19157|PIN2_CAEEL LIM domain-containing protein pin-2 OS=Caenorhabditis elegans GN=pin-2 PE=2 SV=2 1517 1703 8.0E-09
sp|Q9JKU8|LMX1A_MOUSE LIM homeobox transcription factor 1-alpha OS=Mus musculus GN=Lmx1a PE=2 SV=1 1500 1622 8.0E-09
sp|Q04650|LMX1A_MESAU LIM homeobox transcription factor 1-alpha OS=Mesocricetus auratus GN=LMX1A PE=2 SV=1 1500 1622 8.0E-09
sp|Q6P7E4|PDLI7_DANRE PDZ and LIM domain protein 7 OS=Danio rerio GN=pdlim7 PE=2 SV=1 1558 1706 9.0E-09
sp|Q679P3|PDLI7_CHICK PDZ and LIM domain protein 7 OS=Gallus gallus GN=PDLIM7 PE=1 SV=1 1558 1710 9.0E-09
sp|Q9NR12|PDLI7_HUMAN PDZ and LIM domain protein 7 OS=Homo sapiens GN=PDLIM7 PE=1 SV=1 1558 1706 1.0E-08
sp|Q69ZX8|ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus GN=Ablim3 PE=1 SV=2 1492 1599 1.0E-08
sp|P53668|LIMK1_MOUSE LIM domain kinase 1 OS=Mus musculus GN=Limk1 PE=1 SV=1 1500 1597 1.0E-08
sp|P53669|LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus GN=Limk1 PE=1 SV=1 1500 1597 1.0E-08
sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 1500 1595 2.0E-08
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens GN=ABLIM3 PE=1 SV=3 1492 1599 2.0E-08
sp|P53667|LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens GN=LIMK1 PE=1 SV=3 1500 1596 2.0E-08
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 1489 1552 3.0E-08
sp|Q3SX40|PDLI7_BOVIN PDZ and LIM domain protein 7 OS=Bos taurus GN=PDLIM7 PE=2 SV=1 1558 1706 3.0E-08
sp|Q04584|ZYX_CHICK Zyxin OS=Gallus gallus GN=ZYX PE=1 SV=1 1482 1704 3.0E-08
sp|Q14192|FHL2_HUMAN Four and a half LIM domains protein 2 OS=Homo sapiens GN=FHL2 PE=1 SV=3 1501 1702 3.0E-08
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 1500 1595 3.0E-08
sp|O35115|FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus GN=Fhl2 PE=1 SV=1 1501 1702 4.0E-08
sp|Q1LWV4|LHX9_DANRE LIM/homeobox protein Lhx9 OS=Danio rerio GN=lhx9 PE=2 SV=1 1500 1618 4.0E-08
sp|P53670|LIMK2_RAT LIM domain kinase 2 OS=Rattus norvegicus GN=Limk2 PE=2 SV=1 1501 1595 5.0E-08
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 1448 1557 6.0E-08
sp|O70433|FHL2_MOUSE Four and a half LIM domains protein 2 OS=Mus musculus GN=Fhl2 PE=1 SV=1 1501 1702 6.0E-08
sp|P53408|ISL2A_ONCTS Insulin gene enhancer protein ISL-2A OS=Oncorhynchus tshawytscha GN=isl2a PE=2 SV=1 1482 1618 7.0E-08
sp|O54785|LIMK2_MOUSE LIM domain kinase 2 OS=Mus musculus GN=Limk2 PE=1 SV=2 1501 1595 8.0E-08
sp|Q2YDK0|FHL5_BOVIN Four and a half LIM domains protein 5 OS=Bos taurus GN=FHL5 PE=2 SV=1 1501 1701 1.0E-07
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 1501 1599 2.0E-07
sp|Q2TBC4|PRIC4_HUMAN Prickle-like protein 4 OS=Homo sapiens GN=PRICKLE4 PE=2 SV=2 1520 1599 2.0E-07
sp|P53666|LIMK2_CHICK LIM domain kinase 2 OS=Gallus gallus GN=LIMK2 PE=2 SV=1 1501 1595 2.0E-07
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 1496 1563 2.0E-07
sp|P53405|ISL1_DANRE Insulin gene enhancer protein isl-1 OS=Danio rerio GN=isl1 PE=2 SV=1 1492 1599 3.0E-07
sp|P61374|ISL1_RAT Insulin gene enhancer protein ISL-1 OS=Rattus norvegicus GN=Isl1 PE=2 SV=1 1492 1599 4.0E-07
sp|P61372|ISL1_MOUSE Insulin gene enhancer protein ISL-1 OS=Mus musculus GN=Isl1 PE=1 SV=1 1492 1599 4.0E-07
sp|P61373|ISL1_MESAU Insulin gene enhancer protein ISL-1 OS=Mesocricetus auratus GN=ISL1 PE=2 SV=1 1492 1599 4.0E-07
sp|P61371|ISL1_HUMAN Insulin gene enhancer protein ISL-1 OS=Homo sapiens GN=ISL1 PE=1 SV=1 1492 1599 4.0E-07
sp|P50211|ISL1_CHICK Insulin gene enhancer protein ISL-1 OS=Gallus gallus GN=ISL1 PE=2 SV=1 1492 1599 4.0E-07
sp|Q2KI95|FHL2_BOVIN Four and a half LIM domains protein 2 OS=Bos taurus GN=FHL2 PE=2 SV=1 1501 1701 8.0E-07
sp|G5E5X0|LIMD1_BOVIN LIM domain-containing protein 1 OS=Bos taurus GN=LIMD1 PE=3 SV=1 1491 1701 1.0E-06
sp|B7ZUL2|LIMD1_XENTR LIM domain-containing protein 1 OS=Xenopus tropicalis GN=limd1 PE=2 SV=1 1482 1708 1.0E-06
sp|O42565|LIMK1_XENLA LIM domain kinase 1 OS=Xenopus laevis GN=limk1 PE=2 SV=1 1484 1595 1.0E-06
sp|P67967|CSRP1_COTJA Cysteine and glycine-rich protein 1 OS=Coturnix coturnix japonica GN=CSRP1 PE=2 SV=2 1466 1559 1.0E-06
sp|P67966|CSRP1_CHICK Cysteine and glycine-rich protein 1 OS=Gallus gallus GN=CSRP1 PE=1 SV=2 1466 1559 1.0E-06
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 1496 1557 2.0E-06
sp|B5DEH0|LIMD1_RAT LIM domain-containing protein 1 OS=Rattus norvegicus GN=Limd1 PE=1 SV=1 1491 1701 3.0E-06
sp|A9LS46|WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis GN=wtip PE=2 SV=1 1500 1681 3.0E-06
sp|Q62523|ZYX_MOUSE Zyxin OS=Mus musculus GN=Zyx PE=1 SV=2 1501 1701 4.0E-06
sp|Q4R7A4|FHL5_MACFA Four and a half LIM domains protein 5 OS=Macaca fascicularis GN=FHL5 PE=2 SV=1 1501 1701 4.0E-06
sp|Q55DS4|LIMG_DICDI LIM domain-containing protein G OS=Dictyostelium discoideum GN=limG PE=3 SV=1 1488 1701 4.0E-06
sp|Q15942|ZYX_HUMAN Zyxin OS=Homo sapiens GN=ZYX PE=1 SV=1 1500 1701 5.0E-06
sp|Q13642|FHL1_HUMAN Four and a half LIM domains protein 1 OS=Homo sapiens GN=FHL1 PE=1 SV=4 1520 1702 5.0E-06
sp|Q9UGP4|LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens GN=LIMD1 PE=1 SV=1 1491 1701 6.0E-06
sp|A8DZE6|WTIP_DANRE Wilms tumor protein 1-interacting protein homolog OS=Danio rerio GN=wtip PE=3 SV=1 1500 1680 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|110290
MAQNQSYAQYPYIAQPQNIYQQLGKPQPQPHLQSAYQQQPQQQQQLVHVPQQQPQYQYTYQHQQQQQQPLPIQNV
QRVPSAQGFQSSSFPNSPAFTHQIASQPHQQHQQQSVYSYSPQGVQTPSLASTTYQQRPPSQNNSCIPTSSFLNL
TPGHPMQNVLPRQIGNNQAAGQLVPASQSLGLRGASPAMPPGPPISPSAMFAQQTQAQRQPPPVSLGSAGRNTAG
VPVQKQILPPPQTQTQSQLQLSIQQQVPSQPQSQPGTQPPPLPPRHQPQQQTQQQQGSPPKPATQRRPLPSPGAQ
RSFPSINTSVSSVNTSMSTTVGTPTSSSISNTSPTRSGLASAQTISQPTSPNKIAVPSSNSRAPTSPTKSSRPLP
TPGGSSRGSNGGSSGGLSGSSGREGFAGIGAKKNATSITGLPVPSDISAQVANINPFLLKVLPLPEGSTPDVVIP
NNQVTEDSDGSLIRSRASPPKFQPDAVSTSSSPTKATSPSTSYVNTPSSTQGPSGSTRNQAPTSTSPTKNFAPTW
KRTIPEYPQPVFGYAAGMVSDPWTPPKQQPTNTTNKVAPPPKKPASDKITHAEMRNLVEREHVERQLNAAMAQVH
AQAHTQKRIAGMPVSNTSYSAYAMNSRSNPNLHQQQPSKHVRSAAYDDDDDDEEEEESEEEDGSEEDEEEEEDAE
EAKEEQEARRRKHGRKPAQPTVPGKKKKKRKEKKEVKEKKVQKKSKPNSRSTSLPPKKRTSSRPPVIPSTSEDDT
ETTEMTQEETEEEYRRPDTRHAKSSSASSSRFKAKVEKEREMLRKKRSYQQDYVEEYSDISTSKKRDVVPIRRRE
PSPPVQQRQSYHQRPAMASAFRRRSPSPPYPQHSVFEYGRRQESPSPPPNHRTSRRVSPSRIGLLKDAQRKTIKL
RGGNDDDDDVFIDKQKERREAGERWKKDERYRLEREMDDSYMDRNRYADERYTGGYHGHEEEDHYERVRQEERDA
RFASARNSGGRHNRSVINYFPQPQTLARRRGTEEREDQWSKIGWRDERDPKMFNLGRAESPPRPVRDSGFATTHR
GRPASPTRNFPQHQSTRNNPPNPPLASPYHSQPVSPTNGGPTDERGSAGLVTKFTAIKIQGLDRSNGRIDQGEWP
VDLPRLPRTPGETSNTSAGGYFDIPPNRDVYSTSGSGPHPPTEFARMSGRSPAAGNYDTSRSTGPARKNSHSPHH
HSNLQMNLDDPPPRSLSPAISQGSNSYARNNDHLQHKRVQSQPQPITHSSMPQRRSVYNNNTTPEPEPPSPIKPR
PQSQGYAHQTHPSQTPSPRPRSINPLDRANMNTSNIHNGTPKVQTINIESPAPVGGREKKADLNRMMSDPEDDGF
ATPVPRNSRRDDGNRRRNMNPSRESIIQVDSPRGPTIQIDESRGPIVQVESPRGPMIQVESPRAPIIQVDSPRGP
SVNVDSPQGPMINVESSPPHNNTYSTPNVQVFNVPGISVAGPEFDDGHDHQRTLNPTSHRGQKQNHPRPNRGGLI
CGGCDGPIIGRIVSAMGARWHPQCFRCTVCNELLEHVSSYEHDGKPYCHLDYHENFAPRCFSCKTSIVEERFISL
DDPALGKRTYHESHFFCAECGDPFLAPSMSHSSRTGELNVQGDGEFESDDVGFTVYKGHPYCEACHVRLRLPKCK
KCKKSIRDHEQAVEALGGKWCWGCFVCANCERPFENPSFFQRGDKPFCERCFDIMLRNEV*
Coding >AgabiH97|110290
ATGGCTCAGAACCAGTCGTATGCACAATACCCATATATTGCTCAACCGCAGAATATCTACCAACAACTCGGAAAG
CCCCAGCCTCAACCGCATTTACAGTCTGCATACCAGCAGCAACCACAGCAACAGCAACAGCTTGTTCATGTACCA
CAGCAACAACCACAGTATCAATATACATACCAGCATCAGCAACAACAGCAACAACCATTACCAATTCAGAATGTA
CAACGCGTTCCGTCGGCGCAGGGATTTCAATCATCATCTTTTCCAAATTCGCCTGCATTCACGCACCAGATAGCA
TCGCAACCACACCAACAACACCAACAACAATCAGTGTATTCATATTCACCGCAAGGAGTACAGACTCCGTCGCTC
GCATCGACGACGTACCAACAACGTCCACCTTCCCAAAATAATTCTTGCATCCCGACCTCATCATTTTTGAACCTT
ACGCCTGGTCATCCCATGCAAAATGTACTACCTAGGCAAATTGGGAATAATCAGGCTGCCGGACAACTTGTTCCT
GCGTCGCAATCACTAGGATTAAGAGGCGCTAGTCCTGCGATGCCACCTGGTCCTCCCATATCACCCTCTGCCATG
TTTGCGCAACAAACTCAAGCTCAGCGCCAGCCTCCGCCAGTCTCTTTAGGATCAGCGGGTAGGAATACAGCGGGT
GTTCCGGTGCAAAAGCAAATTTTGCCCCCTCCACAAACGCAAACGCAATCTCAACTTCAACTTTCAATACAGCAA
CAGGTACCATCTCAACCTCAATCTCAACCTGGAACTCAGCCTCCTCCGCTTCCTCCACGGCATCAGCCTCAACAA
CAAACGCAGCAACAGCAGGGATCACCTCCTAAACCTGCGACTCAACGTCGACCCCTTCCTTCTCCCGGAGCACAA
CGCTCATTCCCCTCCATCAACACTTCGGTTTCGTCTGTCAACACCTCAATGAGTACTACCGTAGGAACTCCTACG
TCATCTTCTATTTCTAATACGTCTCCTACTCGGAGTGGTCTTGCGTCAGCGCAGACAATCTCACAACCTACCTCA
CCTAACAAAATAGCTGTACCATCATCTAATAGCAGAGCACCAACTTCGCCTACTAAGTCTAGTCGTCCACTACCA
ACCCCTGGGGGCAGTAGTAGAGGAAGTAATGGGGGATCTTCGGGAGGTCTTTCTGGCAGCTCGGGAAGAGAAGGT
TTTGCAGGTATCGGAGCGAAGAAAAATGCAACCTCTATCACCGGTTTACCTGTGCCCTCGGACATATCCGCTCAG
GTGGCAAACATTAATCCTTTTCTTTTAAAGGTACTTCCTCTTCCCGAAGGAAGCACTCCTGACGTTGTCATTCCA
AATAATCAAGTAACGGAGGATTCTGATGGTTCGTTGATCAGAAGTCGAGCGAGTCCTCCTAAATTTCAGCCCGAC
GCTGTTTCAACTAGCTCTAGTCCCACTAAAGCGACATCACCGTCTACGTCTTACGTCAATACCCCGTCATCGACA
CAAGGACCGAGCGGTTCTACTCGTAACCAGGCGCCAACAAGTACCTCTCCGACGAAAAATTTCGCACCAACTTGG
AAACGTACTATACCTGAATACCCGCAACCTGTTTTCGGATATGCGGCGGGGATGGTTTCAGATCCTTGGACACCT
CCAAAGCAACAACCCACGAACACCACAAATAAAGTGGCCCCTCCACCAAAGAAACCTGCCTCAGACAAAATAACT
CATGCTGAAATGAGAAACTTAGTTGAGCGGGAACATGTGGAAAGACAATTGAATGCTGCTATGGCTCAGGTCCAT
GCTCAAGCGCATACTCAAAAACGAATCGCTGGGATGCCGGTTTCAAATACGTCATATTCGGCATATGCGATGAAT
TCGCGTTCGAATCCCAATTTACATCAACAGCAACCATCTAAGCATGTACGTTCTGCCGCCTATGACGACGATGAT
GATGACGAGGAGGAGGAGGAGAGTGAAGAAGAGGATGGAAGTGAGGAGGATGAAGAGGAAGAGGAAGATGCAGAG
GAAGCAAAAGAAGAGCAAGAAGCTCGAAGACGTAAGCACGGCAGAAAACCAGCTCAGCCCACCGTCCCAGGAAAG
AAAAAGAAAAAGAGAAAGGAGAAAAAAGAGGTGAAAGAGAAAAAAGTTCAAAAGAAATCTAAACCTAATTCTCGA
TCCACTTCCTTACCTCCCAAAAAGCGAACTTCTTCACGACCACCCGTCATCCCATCTACATCTGAAGACGACACA
GAGACTACTGAAATGACACAGGAAGAAACTGAGGAAGAATATCGTCGTCCTGATACTCGACATGCTAAATCCTCT
TCTGCGTCATCATCCCGATTTAAAGCGAAAGTGGAGAAGGAAAGAGAGATGCTGAGGAAGAAGAGATCTTATCAA
CAAGACTATGTTGAAGAGTATAGTGATATCAGTACATCAAAGAAACGGGATGTAGTTCCGATCAGGAGGAGAGAG
CCCTCACCTCCCGTGCAACAACGACAATCATATCATCAGCGTCCTGCGATGGCTTCTGCTTTCAGGCGAAGGTCA
CCTTCGCCTCCTTACCCCCAGCACTCTGTGTTTGAATATGGAAGAAGACAAGAATCTCCGTCCCCACCTCCGAAT
CACCGTACTTCGAGGAGGGTGTCGCCATCGAGAATCGGTTTACTCAAAGATGCACAGAGGAAAACAATCAAGTTA
CGTGGGGGTAATGATGATGACGACGACGTGTTTATAGATAAACAGAAAGAGCGGAGAGAAGCCGGAGAGAGGTGG
AAAAAGGATGAGCGGTATCGGTTAGAAAGGGAGATGGACGATTCATATATGGATCGGAATAGATATGCGGATGAG
AGGTATACTGGTGGCTATCATGGCCATGAAGAAGAAGATCACTATGAACGAGTACGACAAGAGGAAAGGGATGCA
CGTTTTGCGAGTGCACGTAACTCTGGAGGACGTCATAATAGGAGCGTCATTAACTACTTTCCTCAACCTCAAACG
TTGGCTCGAAGGCGAGGTACTGAAGAACGCGAAGATCAGTGGTCGAAAATTGGGTGGCGTGATGAACGGGACCCC
AAGATGTTTAACCTTGGTCGAGCTGAATCGCCTCCCCGTCCCGTTCGTGATTCAGGGTTCGCTACTACCCATCGA
GGTCGACCCGCTTCCCCAACACGAAACTTTCCTCAGCATCAATCGACTAGGAATAACCCACCTAACCCACCTCTC
GCGTCTCCGTATCACAGCCAACCGGTTTCACCGACCAATGGTGGGCCTACTGATGAGCGCGGTAGTGCTGGTTTA
GTAACAAAGTTCACAGCCATTAAAATCCAAGGTCTGGACAGGAGTAATGGGCGTATTGATCAGGGAGAATGGCCT
GTGGATCTCCCAAGGCTACCGAGAACTCCCGGAGAGACGTCTAATACCTCGGCCGGTGGATACTTTGACATTCCT
CCAAACCGAGACGTGTATTCCACTTCCGGATCAGGTCCCCACCCCCCGACAGAATTCGCTCGGATGAGCGGACGA
TCGCCTGCAGCAGGTAATTATGACACTAGCCGCTCTACCGGGCCAGCGCGAAAAAACTCCCATAGTCCCCATCAT
CATAGCAATCTTCAAATGAACTTGGATGATCCTCCACCGAGGTCATTATCTCCCGCTATTTCACAAGGGTCAAAC
TCGTATGCAAGGAACAATGACCATCTTCAACATAAACGGGTCCAGTCACAACCACAACCCATCACTCATAGCTCT
ATGCCACAACGAAGATCTGTCTATAACAACAATACCACCCCCGAGCCTGAACCCCCGTCCCCAATCAAGCCACGA
CCACAAAGTCAAGGATATGCTCATCAAACGCATCCCTCACAAACCCCATCTCCACGCCCTCGATCTATAAACCCA
CTTGATCGTGCGAATATGAATACCTCTAACATCCACAATGGGACACCTAAAGTTCAAACTATCAACATTGAGAGT
CCTGCACCTGTTGGAGGAAGAGAGAAAAAAGCCGACTTGAATAGGATGATGAGTGATCCAGAGGATGATGGATTC
GCGACACCTGTACCCCGGAATAGCAGACGTGACGATGGTAACCGGAGGCGAAATATGAATCCTTCTCGAGAATCT
ATCATCCAAGTGGATTCACCAAGAGGTCCTACGATACAGATAGATGAATCGAGAGGACCCATCGTACAAGTTGAA
TCACCTAGGGGACCAATGATACAAGTGGAGTCACCGAGAGCTCCCATTATCCAGGTTGATTCGCCTAGAGGACCA
AGTGTCAACGTCGACTCGCCTCAAGGACCTATGATCAATGTGGAATCGTCACCCCCGCACAACAACACTTATTCC
ACGCCAAATGTGCAAGTTTTCAATGTACCGGGTATCAGTGTAGCTGGACCAGAGTTCGACGACGGACACGATCAT
CAGAGAACTTTGAATCCAACATCACATCGAGGGCAAAAGCAGAATCATCCGAGACCCAATCGTGGTGGGTTGATT
TGCGGTGGATGCGATGGCCCAATCATTGGTCGTATTGTCAGTGCGATGGGTGCTCGTTGGCATCCCCAATGTTTC
AGATGCACGGTATGTAATGAGCTGCTGGAGCATGTTAGCTCGTATGAGCATGATGGGAAACCCTACTGTCACCTG
GACTACCATGAGAATTTTGCACCCCGCTGTTTCTCTTGCAAAACTTCCATTGTTGAGGAGCGTTTCATCAGCCTC
GATGATCCTGCACTCGGCAAGAGAACGTACCACGAATCGCATTTCTTCTGTGCTGAATGCGGCGATCCGTTCCTC
GCCCCATCAATGAGTCATTCGTCACGTACCGGAGAGTTAAACGTTCAGGGAGATGGAGAATTCGAATCTGACGAT
GTTGGGTTTACGGTGTATAAGGGACATCCTTATTGCGAAGCATGTCATGTCCGACTCCGACTGCCGAAGTGCAAA
AAATGTAAAAAGAGCATCAGAGATCATGAACAAGCTGTCGAGGCGCTGGGAGGGAAATGGTGCTGGGGTTGTTTT
GTCTGCGCAAACTGTGAGAGACCTTTTGAGAACCCGTCGTTCTTCCAGAGAGGGGATAAACCATTCTGCGAGCGG
TGTTTTGACATCATGCTCAGGAATGAAGTTTGA
Transcript >AgabiH97|110290
ATGGCTCAGAACCAGTCGTATGCACAATACCCATATATTGCTCAACCGCAGAATATCTACCAACAACTCGGAAAG
CCCCAGCCTCAACCGCATTTACAGTCTGCATACCAGCAGCAACCACAGCAACAGCAACAGCTTGTTCATGTACCA
CAGCAACAACCACAGTATCAATATACATACCAGCATCAGCAACAACAGCAACAACCATTACCAATTCAGAATGTA
CAACGCGTTCCGTCGGCGCAGGGATTTCAATCATCATCTTTTCCAAATTCGCCTGCATTCACGCACCAGATAGCA
TCGCAACCACACCAACAACACCAACAACAATCAGTGTATTCATATTCACCGCAAGGAGTACAGACTCCGTCGCTC
GCATCGACGACGTACCAACAACGTCCACCTTCCCAAAATAATTCTTGCATCCCGACCTCATCATTTTTGAACCTT
ACGCCTGGTCATCCCATGCAAAATGTACTACCTAGGCAAATTGGGAATAATCAGGCTGCCGGACAACTTGTTCCT
GCGTCGCAATCACTAGGATTAAGAGGCGCTAGTCCTGCGATGCCACCTGGTCCTCCCATATCACCCTCTGCCATG
TTTGCGCAACAAACTCAAGCTCAGCGCCAGCCTCCGCCAGTCTCTTTAGGATCAGCGGGTAGGAATACAGCGGGT
GTTCCGGTGCAAAAGCAAATTTTGCCCCCTCCACAAACGCAAACGCAATCTCAACTTCAACTTTCAATACAGCAA
CAGGTACCATCTCAACCTCAATCTCAACCTGGAACTCAGCCTCCTCCGCTTCCTCCACGGCATCAGCCTCAACAA
CAAACGCAGCAACAGCAGGGATCACCTCCTAAACCTGCGACTCAACGTCGACCCCTTCCTTCTCCCGGAGCACAA
CGCTCATTCCCCTCCATCAACACTTCGGTTTCGTCTGTCAACACCTCAATGAGTACTACCGTAGGAACTCCTACG
TCATCTTCTATTTCTAATACGTCTCCTACTCGGAGTGGTCTTGCGTCAGCGCAGACAATCTCACAACCTACCTCA
CCTAACAAAATAGCTGTACCATCATCTAATAGCAGAGCACCAACTTCGCCTACTAAGTCTAGTCGTCCACTACCA
ACCCCTGGGGGCAGTAGTAGAGGAAGTAATGGGGGATCTTCGGGAGGTCTTTCTGGCAGCTCGGGAAGAGAAGGT
TTTGCAGGTATCGGAGCGAAGAAAAATGCAACCTCTATCACCGGTTTACCTGTGCCCTCGGACATATCCGCTCAG
GTGGCAAACATTAATCCTTTTCTTTTAAAGGTACTTCCTCTTCCCGAAGGAAGCACTCCTGACGTTGTCATTCCA
AATAATCAAGTAACGGAGGATTCTGATGGTTCGTTGATCAGAAGTCGAGCGAGTCCTCCTAAATTTCAGCCCGAC
GCTGTTTCAACTAGCTCTAGTCCCACTAAAGCGACATCACCGTCTACGTCTTACGTCAATACCCCGTCATCGACA
CAAGGACCGAGCGGTTCTACTCGTAACCAGGCGCCAACAAGTACCTCTCCGACGAAAAATTTCGCACCAACTTGG
AAACGTACTATACCTGAATACCCGCAACCTGTTTTCGGATATGCGGCGGGGATGGTTTCAGATCCTTGGACACCT
CCAAAGCAACAACCCACGAACACCACAAATAAAGTGGCCCCTCCACCAAAGAAACCTGCCTCAGACAAAATAACT
CATGCTGAAATGAGAAACTTAGTTGAGCGGGAACATGTGGAAAGACAATTGAATGCTGCTATGGCTCAGGTCCAT
GCTCAAGCGCATACTCAAAAACGAATCGCTGGGATGCCGGTTTCAAATACGTCATATTCGGCATATGCGATGAAT
TCGCGTTCGAATCCCAATTTACATCAACAGCAACCATCTAAGCATGTACGTTCTGCCGCCTATGACGACGATGAT
GATGACGAGGAGGAGGAGGAGAGTGAAGAAGAGGATGGAAGTGAGGAGGATGAAGAGGAAGAGGAAGATGCAGAG
GAAGCAAAAGAAGAGCAAGAAGCTCGAAGACGTAAGCACGGCAGAAAACCAGCTCAGCCCACCGTCCCAGGAAAG
AAAAAGAAAAAGAGAAAGGAGAAAAAAGAGGTGAAAGAGAAAAAAGTTCAAAAGAAATCTAAACCTAATTCTCGA
TCCACTTCCTTACCTCCCAAAAAGCGAACTTCTTCACGACCACCCGTCATCCCATCTACATCTGAAGACGACACA
GAGACTACTGAAATGACACAGGAAGAAACTGAGGAAGAATATCGTCGTCCTGATACTCGACATGCTAAATCCTCT
TCTGCGTCATCATCCCGATTTAAAGCGAAAGTGGAGAAGGAAAGAGAGATGCTGAGGAAGAAGAGATCTTATCAA
CAAGACTATGTTGAAGAGTATAGTGATATCAGTACATCAAAGAAACGGGATGTAGTTCCGATCAGGAGGAGAGAG
CCCTCACCTCCCGTGCAACAACGACAATCATATCATCAGCGTCCTGCGATGGCTTCTGCTTTCAGGCGAAGGTCA
CCTTCGCCTCCTTACCCCCAGCACTCTGTGTTTGAATATGGAAGAAGACAAGAATCTCCGTCCCCACCTCCGAAT
CACCGTACTTCGAGGAGGGTGTCGCCATCGAGAATCGGTTTACTCAAAGATGCACAGAGGAAAACAATCAAGTTA
CGTGGGGGTAATGATGATGACGACGACGTGTTTATAGATAAACAGAAAGAGCGGAGAGAAGCCGGAGAGAGGTGG
AAAAAGGATGAGCGGTATCGGTTAGAAAGGGAGATGGACGATTCATATATGGATCGGAATAGATATGCGGATGAG
AGGTATACTGGTGGCTATCATGGCCATGAAGAAGAAGATCACTATGAACGAGTACGACAAGAGGAAAGGGATGCA
CGTTTTGCGAGTGCACGTAACTCTGGAGGACGTCATAATAGGAGCGTCATTAACTACTTTCCTCAACCTCAAACG
TTGGCTCGAAGGCGAGGTACTGAAGAACGCGAAGATCAGTGGTCGAAAATTGGGTGGCGTGATGAACGGGACCCC
AAGATGTTTAACCTTGGTCGAGCTGAATCGCCTCCCCGTCCCGTTCGTGATTCAGGGTTCGCTACTACCCATCGA
GGTCGACCCGCTTCCCCAACACGAAACTTTCCTCAGCATCAATCGACTAGGAATAACCCACCTAACCCACCTCTC
GCGTCTCCGTATCACAGCCAACCGGTTTCACCGACCAATGGTGGGCCTACTGATGAGCGCGGTAGTGCTGGTTTA
GTAACAAAGTTCACAGCCATTAAAATCCAAGGTCTGGACAGGAGTAATGGGCGTATTGATCAGGGAGAATGGCCT
GTGGATCTCCCAAGGCTACCGAGAACTCCCGGAGAGACGTCTAATACCTCGGCCGGTGGATACTTTGACATTCCT
CCAAACCGAGACGTGTATTCCACTTCCGGATCAGGTCCCCACCCCCCGACAGAATTCGCTCGGATGAGCGGACGA
TCGCCTGCAGCAGGTAATTATGACACTAGCCGCTCTACCGGGCCAGCGCGAAAAAACTCCCATAGTCCCCATCAT
CATAGCAATCTTCAAATGAACTTGGATGATCCTCCACCGAGGTCATTATCTCCCGCTATTTCACAAGGGTCAAAC
TCGTATGCAAGGAACAATGACCATCTTCAACATAAACGGGTCCAGTCACAACCACAACCCATCACTCATAGCTCT
ATGCCACAACGAAGATCTGTCTATAACAACAATACCACCCCCGAGCCTGAACCCCCGTCCCCAATCAAGCCACGA
CCACAAAGTCAAGGATATGCTCATCAAACGCATCCCTCACAAACCCCATCTCCACGCCCTCGATCTATAAACCCA
CTTGATCGTGCGAATATGAATACCTCTAACATCCACAATGGGACACCTAAAGTTCAAACTATCAACATTGAGAGT
CCTGCACCTGTTGGAGGAAGAGAGAAAAAAGCCGACTTGAATAGGATGATGAGTGATCCAGAGGATGATGGATTC
GCGACACCTGTACCCCGGAATAGCAGACGTGACGATGGTAACCGGAGGCGAAATATGAATCCTTCTCGAGAATCT
ATCATCCAAGTGGATTCACCAAGAGGTCCTACGATACAGATAGATGAATCGAGAGGACCCATCGTACAAGTTGAA
TCACCTAGGGGACCAATGATACAAGTGGAGTCACCGAGAGCTCCCATTATCCAGGTTGATTCGCCTAGAGGACCA
AGTGTCAACGTCGACTCGCCTCAAGGACCTATGATCAATGTGGAATCGTCACCCCCGCACAACAACACTTATTCC
ACGCCAAATGTGCAAGTTTTCAATGTACCGGGTATCAGTGTAGCTGGACCAGAGTTCGACGACGGACACGATCAT
CAGAGAACTTTGAATCCAACATCACATCGAGGGCAAAAGCAGAATCATCCGAGACCCAATCGTGGTGGGTTGATT
TGCGGTGGATGCGATGGCCCAATCATTGGTCGTATTGTCAGTGCGATGGGTGCTCGTTGGCATCCCCAATGTTTC
AGATGCACGGTATGTAATGAGCTGCTGGAGCATGTTAGCTCGTATGAGCATGATGGGAAACCCTACTGTCACCTG
GACTACCATGAGAATTTTGCACCCCGCTGTTTCTCTTGCAAAACTTCCATTGTTGAGGAGCGTTTCATCAGCCTC
GATGATCCTGCACTCGGCAAGAGAACGTACCACGAATCGCATTTCTTCTGTGCTGAATGCGGCGATCCGTTCCTC
GCCCCATCAATGAGTCATTCGTCACGTACCGGAGAGTTAAACGTTCAGGGAGATGGAGAATTCGAATCTGACGAT
GTTGGGTTTACGGTGTATAAGGGACATCCTTATTGCGAAGCATGTCATGTCCGACTCCGACTGCCGAAGTGCAAA
AAATGTAAAAAGAGCATCAGAGATCATGAACAAGCTGTCGAGGCGCTGGGAGGGAAATGGTGCTGGGGTTGTTTT
GTCTGCGCAAACTGTGAGAGACCTTTTGAGAACCCGTCGTTCTTCCAGAGAGGGGATAAACCATTCTGCGAGCGG
TGTTTTGACATCATGCTCAGGAATGAAGTTTGA
Gene >AgabiH97|110290
ATGGCTCAGAACCAGTCGTATGCACAATACCCATATATTGCTCAACCGCAGAATATCTACCAACAACTCGGAAAG
CCCCAGCCTCAACCGCATTTACAGTCTGCATACCAGCAGCAACCACAGCAACAGCAACAGCTTGTTCATGTACCA
CAGCAACAACCACAGTATCAATATACATACCAGCATCAGCAACAACAGCAACAACCATTACCAATTCAGAATGTA
CAACGCGTTCCGTCGGCGCAGGGATTTCAATCATCATCTTTTCCAAATTCGCCTGCATTCACGCACCAGATAGCA
TCGCAACCACACCAACAACACCAACAACAATCAGTGTATTCATATTCACCGCAAGGAGTACAGACTCCGTCGCTC
GCATCGACGACGTACCAACAACGTCCACCTTCCCAAAATAATTCTTGCATCCCGACCTCATCATTTTTGAACCTT
ACGCCTGGTCATCCCATGCAAAATGTACTACCTAGGCAAATTGGGAATAATCAGGCTGCCGGACAACTTGTTCCT
GCGTCGCAATCACTAGGATTAAGAGGCGCTAGTCCTGCGATGCCACCTGGTCCTCCCATATCACCCTCTGCCATG
TTTGCGCAACAAACTCAAGCTCAGCGCCAGCCTCCGCCAGTCTCTTTAGGATCAGCGGGTAGGAATACAGCGGGT
GTTCCGGTGCAAAAGCAAATTTTGCCCCCTCCACAAACGCAAACGCAATCTCAACTTCAACTTTCAATACAGCAA
CAGGTACCATCTCAACCTCAATCTCAACCTGGAACTCAGCCTCCTCCGCTTCCTCCACGGCATCAGCCTCAACAA
CAAACGCAGCAACAGCAGGGATCACCTCCTAAACCTGCGACTCAACGTCGACCCCTTCCTTCTCCCGGAGCACAA
CGCTCATTCCCCTCCATCAACACTTCGGTTTCGTCTGTCAACACCTCAATGAGTACTACCGTAGGAACTCCTACG
TCATCTTCTATTTCTAATACGTCTCCTACTCGGAGTGGTCTTGCGTCAGCGCAGACAATCTCACAACCTACCTCA
CCTAACAAAATAGCTGTACCATCATCTAATAGCAGAGCACCAACTTCGCCTACTAAGTCTAGTCGTCCACTACCA
ACCCCTGGGGGCAGTAGTAGAGGAAGTAATGGGGGATCTTCGGGAGGTCTTTCTGGCAGCTCGGGAAGAGAAGGT
TTTGCAGGTATCGGAGCGAAGAAAAATGCAACCTCTATCACCGGTTTACCTGTGCCCTCGGACATATCCGCTCAG
GTGGCAAACATTAATCCTTTTCTTTTAAAGGTACTTCCTCTTCCCGAAGGAAGCACTCCTGACGTTGTCATTCCA
AATAATCAAGTAACGGAGGATTCTGATGGTTCGTTGATCAGAAGTCGAGCGAGTCCTCCTAAATTTCAGCCCGAC
GCTGTTTCAACTAGCTCTAGTCCCACTAAAGCGACATCACCGTCTACGTCTTACGTCAATACCCCGTCATCGACA
CAAGGACCGAGCGGTTCTACTCGTAACCAGGCGCCAACAAGTACCTCTCCGACGAAAAATTTCGCACCAACTTGG
AAACGTACTATACCTGAATACCCGCAACCTGTTTTCGGATATGCGGCGGGGATGGTTTCAGATCCTTGGACACCT
CCAAAGCAACAACCCACGAACACCACAAATAAAGTGGCCCCTCCACCAAAGAAACCTGTAAGCTTATTCAACTTT
CACAATTTATAAATCATTAACTAATACAAATGCTTCATTCAAGGCCTCAGACAAAATAACTCATGCTGAAATGAG
AAACTTAGTTGAGCGGGAACATGTGGAAAGACAATTGAATGCTGCTATGGCTCAGGTCCATGCTCAAGCGCATAC
TCAAAAACGAATCGCTGGGATGGTACGAATCTTTGACATTCGTGTACTTTTGATCGATCGTATTAATCGTTTTTT
AAAGCCGGTTTCAAATACGTCATATTCGGCATATGCGATGAATTCGCGTTCGAATCCCAATTTACATCAACAGCA
ACCATCTAAGCATGTACGTTCTGCCGCCTATGACGACGATGATGATGACGAGGAGGAGGAGGAGAGTGAAGAAGA
GGATGGAAGTGAGGAGGATGAAGAGGAAGAGGAAGATGCAGAGGAAGCAAAAGAAGAGCAAGAAGCTCGAAGACG
TAAGCACGGCAGAAAACCAGCTCAGCCCACCGTCCCAGGAAAGAAAAAGAAAAAGAGAAAGGAGAAAAAAGAGGT
GAAAGAGAAAAAAGTTCAAAAGAAATCTAAACCTAATTCTCGATCCACTTCCTTACCTCCCAAAAAGCGAACTTC
TTCACGACCACCCGTCATCCCATCTACATCTGAAGACGACACAGAGACTACTGAAATGACACAGGAAGAAACTGA
GGAAGAATATCGTCGTCCTGATACTCGACATGCTAAATCCTCTTCTGCGTCATCATCCCGATTTAAAGCGAAAGT
GGAGAAGGAAAGAGAGATGCTGAGGAAGAAGAGATCTTATCAACAAGACTATGTTGAAGAGTATAGTGATATCAG
TACATCAAAGAAACGGGATGTAGTTCCGATCAGGAGGAGAGAGCCCTCACCTCCCGTGCAACAACGACAATCATA
TCATCAGCGTCCTGCGATGGCTTCTGCTTTCAGGCGAAGGTCACCTTCGCCTCCTTACCCCCAGCACTCTGTGTT
TGAATATGGAAGAAGACAAGAATCTCCGTCCCCACCTCCGAATCACCGTACTTCGAGGAGGGTGTCGCCATCGAG
AATCGGTTTACTCAAAGATGCACAGAGGAAAACAATCAAGTTACGTGGGGGTAATGATGATGACGACGACGTGTT
TATAGATAAACAGAAAGAGCGGAGAGAAGCCGGAGAGAGGTGGAAAAAGGATGAGCGGTATCGGTTAGAAAGGGA
GATGGACGATTCATATATGGATCGGAATAGATATGCGGATGAGAGGTATACTGGTGGCTATCATGGCCATGAAGA
AGAAGATCACTATGAACGAGTACGACAAGAGGAAAGGGATGCACGTTTTGCGAGTGCACGTAACTCTGGAGGACG
TCATAATAGGAGCGTCATTAACTACTTTCCTCAACCTCAAACGTTGGCTCGAAGGCGAGGTACTGAAGAACGCGA
AGATCAGTGGTCGAAAATTGGGTGGCGTGATGAACGGGACCCCAAGATGTTTAACCTTGGTCGAGCTGAATCGCC
TCCCCGTCCCGTTCGTGATTCAGGGTTCGCTACTACCCATCGAGGTCGACCCGCTTCCCCAACACGAAACTTTCC
TCAGCATCAATCGACTAGGAATAACCCACCTAACCCACCTCTCGCGTCTCCGTATCACAGCCAACCGGTTTCACC
GACCAATGGTGGGCCTACTGATGAGCGCGGTAGTGCTGGTTTAGTAACAAAGTTCACAGCCATTAAAATCCAAGG
TCTGGACAGGAGTAATGGGCGTATTGATCAGGGAGAATGGCCTGTGGATCTCCCAAGGCTACCGAGAACTCCCGG
AGAGACGTCTAATACCTCGGCCGGTGGATACTTTGACATTCCTCCAAACCGAGACGTGTATTCCACTTCCGGATC
AGGTCCCCACCCCCCGACAGAATTCGCTCGGATGAGCGGACGATCGCCTGCAGCAGGTAATTATGACACTAGCCG
CTCTACCGGGCCAGCGCGAAAAAACTCCCATAGTCCCCATCATCATAGCAATCTTCAAATGAACTTGGATGATCC
TCCACCGAGGTCATTATCTCCCGCTATTTCACAAGGGTCAAACTCGTATGCAAGGAACAATGACCATCTTCAACA
TAAACGGGTCCAGTCACAACCACAACCCATCACTCATAGCTCTATGCCACAACGAAGATCTGTCTATAACAACAA
TACCACCCCCGAGCCTGAACCCCCGTCCCCAATCAAGCCACGACCACAAAGTCAAGGATATGCTCATCAAACGCA
TCCCTCACAAACCCCATCTCCACGCCCTCGATCTATAAACCCACTTGATCGTGCGAATATGAATACCTCTAACAT
CCACAATGGGACACCTAAAGTTCAAACTATCAACATTGAGAGTCCTGCACCTGTTGGAGGAAGAGAGAAAAAAGC
CGACTTGAATAGGATGATGAGTGATCCAGAGGATGATGGATTCGCGACACCTGTACCCCGGAATAGCAGACGTGA
CGATGGTAACCGGAGGCGAAATATGAATCCTTCTCGAGAATCTATCATCCAAGTGGATTCACCAAGAGGTCCTAC
GATACAGATAGATGAATCGAGAGGACCCATCGTACAAGTTGAATCACCTAGGGGACCAATGATACAAGTGGAGTC
ACCGAGAGCTCCCATTATCCAGGTTGATTCGCCTAGAGGACCAAGTGTCAACGTCGACTCGCCTCAAGGACCTAT
GATCAATGTGGAATCGTCACCCCCGCACAACAACACTTATTCCACGCCAAATGTGCAAGTTTTCAATGTACCGGG
TATCAGTGTAGCTGGACCAGAGTTCGACGACGGACACGATCATCAGAGAACTTTGAATCCAACATCACATCGAGG
GCAAAAGCAGAATCATCCGAGACCCAATCGTGGTGGGTTGATTTGCGGTGGATGCGATGGCCCAATCATTGGTCG
TATTGTCAGTGCGATGGGTGCTCGTTGGCATCCCCAATGTTTCAGATGCACGGTATGTAATGAGCTGCTGGAGCA
TGTTAGCTCGTATGAGCATGATGGGAAACCCTACTGTCACCTGGACTACCATGAGGTACGTCCTTTTTTGATGAT
CTTCTAACTCTCACAACTCACCTTGCTGACCTTCCCCCTTAGAATTTTGCACCCCGCTGTTTCTCTTGCAAAACT
TCCATTGTTGAGGAGCGTTTCATCAGCCTCGATGATCCTGCACTCGGCAAGAGAACGTACCACGAATCGCATTTC
TTCTGTGCTGAATGCGGCGATCCGTTCCTCGCCCCATCAATGAGTCATTCGTCACGTACCGGAGAGTTAAACGTT
CAGGGAGATGGAGAATTCGAATCTGACGATGTTGGGTTTACGGTGTATAAGGGACATCCTTATTGCGAAGCATGT
CATGTCCGACTCCGACTGCCGAAGTGCAAAAAATGTAAAAAGAGCATCAGAGATCATGAACAAGCTGTCGAGGCG
CTGGGAGGGAAATGGTGCTGGGGTTGTTTTGTCTGCGCAGTACGTGAATTTTCAGTTCTTCCTTCGGGGCCGCGT
TTGACTGACTGTTGTTTCAACTGCCTTTTTTGAAACCAGAACTGTGAGAGACCTTTTGAGAACCCGTCGTTCTTC
CAGAGAGGGGATAAACCATTCTGCGAGCGGTGTTTTGACATCATGCTCAGGAATGAAGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail