Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|110260
Gene name
Locationscaffold_8:1061648..1063016
Strand+
Gene length (bp)1368
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05631 MFS_5 Sugar-tranasporters, 12 TM 5.2E-57 2 277
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-20 9 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q28E13|MFSD5_XENTR Molybdate-anion transporter OS=Xenopus tropicalis GN=mfsd5 PE=2 SV=1 1 345 5.0E-31
sp|Q08B29|MFSD5_XENLA Molybdate-anion transporter OS=Xenopus laevis GN=mfsd5 PE=2 SV=1 1 345 5.0E-31
sp|Q1KKV8|MFSD5_TAKRU Molybdate-anion transporter OS=Takifugu rubripes GN=mfsd5 PE=3 SV=1 6 345 9.0E-31
sp|Q921Y4|MFSD5_MOUSE Molybdate-anion transporter OS=Mus musculus GN=Mfsd5 PE=2 SV=1 1 345 8.0E-28
sp|Q6N075|MFSD5_HUMAN Molybdate-anion transporter OS=Homo sapiens GN=MFSD5 PE=1 SV=2 1 346 3.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q28E13|MFSD5_XENTR Molybdate-anion transporter OS=Xenopus tropicalis GN=mfsd5 PE=2 SV=1 1 345 5.0E-31
sp|Q08B29|MFSD5_XENLA Molybdate-anion transporter OS=Xenopus laevis GN=mfsd5 PE=2 SV=1 1 345 5.0E-31
sp|Q1KKV8|MFSD5_TAKRU Molybdate-anion transporter OS=Takifugu rubripes GN=mfsd5 PE=3 SV=1 6 345 9.0E-31
sp|Q921Y4|MFSD5_MOUSE Molybdate-anion transporter OS=Mus musculus GN=Mfsd5 PE=2 SV=1 1 345 8.0E-28
sp|Q6N075|MFSD5_HUMAN Molybdate-anion transporter OS=Homo sapiens GN=MFSD5 PE=1 SV=2 1 346 3.0E-27
sp|Q0VC03|MFSD5_BOVIN Molybdate-anion transporter OS=Bos taurus GN=MFSD5 PE=2 SV=1 1 345 5.0E-27
sp|Q5R542|MFSD5_PONAB Molybdate-anion transporter OS=Pongo abelii GN=MFSD5 PE=2 SV=1 1 345 1.0E-26
sp|Q6DG19|MFSD5_DANRE Molybdate-anion transporter OS=Danio rerio GN=mfsd5 PE=2 SV=1 6 345 2.0E-26
[Show less]

GO

GO Term Description Terminal node
GO:0015098 molybdate ion transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0015689 molybdate ion transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0015698 inorganic anion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0006820 anion transport No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0009987 cellular process No
GO:0015075 ion transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0006811 ion transport No
GO:0051179 localization No
GO:0008509 anion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 56 75 19
3 80 102 22
4 115 137 22
5 147 166 19
6 203 225 22
7 240 262 22
8 275 297 22
9 307 329 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|110260
MAAYCLQGPYMWSLYRVQYGLPERLVALLFVTGFVSEGVASPLVGAWADQYGRRKLCLAFCVISTFTCILTFLPN
LPTLILGRLCGGISAAILYTAFEPWLVSSASSMGQSSEDLSTIISHATLVNGFVASGAGIISNKLVATTIDFTSP
LVVSGFLLVLGFFVILKTWSENYGDGGRSTTTVLSQTGRLRQAWRLVCEDPALLTVGLTQTCFEGSMYFFAFIWV
PSLQEVSRLNDLLPLGYIFASFMVSITTGSILYNTIVARSKIKGIYSSLTFHAKFSSVICAVSALTFAICVASSY
EDWRYLAFLVFEICVGMYFPVQGMLRGMLISKDYQATVVSLFRLPLMHAPFYLAYPRS*
Coding >AgabiH97|110260
ATGGCTGCGTATTGTTTACAGGGACCCTACATGTGGTCTTTGTACAGGGTACAATACGGATTACCAGAGAGACTG
GTTGCATTACTGTTTGTTACTGGTTTTGTGTCTGAGGGTGTAGCGTCTCCCCTTGTGGGTGCCTGGGCGGATCAA
TACGGTCGACGCAAGCTTTGTCTAGCATTCTGCGTGATTTCAACTTTTACATGCATCCTAACCTTCCTTCCTAAT
CTTCCAACCTTAATCCTTGGTCGCCTTTGTGGCGGAATTTCAGCAGCTATCCTATACACCGCCTTCGAACCGTGG
CTAGTCTCCTCTGCATCATCAATGGGCCAATCATCAGAAGACCTATCAACCATCATCAGTCATGCGACGCTTGTC
AATGGCTTCGTAGCTAGTGGTGCCGGAATTATTAGCAACAAGCTTGTCGCAACGACAATCGACTTCACATCTCCT
TTGGTCGTAAGCGGGTTCCTGCTCGTGCTGGGATTTTTTGTTATTCTCAAAACGTGGTCGGAAAATTACGGCGAT
GGAGGCAGGTCCACAACTACCGTCCTTTCTCAAACTGGGAGATTGAGACAGGCATGGAGACTTGTCTGTGAAGAT
CCTGCGCTGTTAACTGTGGGTTTGACCCAGACATGTTTCGAAGGTTCCATGTACTTTTTCGCTTTCATCTGGGTA
CCGTCCCTTCAAGAAGTCTCTCGCTTAAATGACCTCCTTCCATTGGGTTATATCTTCGCTTCATTCATGGTCTCT
ATTACGACCGGTTCCATCCTCTACAATACAATAGTGGCGCGGAGCAAAATCAAAGGAATTTATTCGTCGTTGACT
TTCCATGCAAAATTCAGCAGTGTTATTTGCGCCGTTAGCGCATTAACATTCGCAATTTGTGTCGCTTCGAGTTAC
GAAGATTGGCGATACTTGGCCTTTCTTGTATTCGAAATCTGTGTTGGCATGTATTTTCCTGTGCAAGGCATGCTA
CGGGGAATGTTGATCTCAAAAGATTATCAGGCAACGGTCGTATCTTTGTTCCGCCTCCCGCTTATGCATGCGCCG
TTTTACTTGGCTTATCCTCGCTCATGA
Transcript >AgabiH97|110260
ATGGCTGCGTATTGTTTACAGGGACCCTACATGTGGTCTTTGTACAGGGTACAATACGGATTACCAGAGAGACTG
GTTGCATTACTGTTTGTTACTGGTTTTGTGTCTGAGGGTGTAGCGTCTCCCCTTGTGGGTGCCTGGGCGGATCAA
TACGGTCGACGCAAGCTTTGTCTAGCATTCTGCGTGATTTCAACTTTTACATGCATCCTAACCTTCCTTCCTAAT
CTTCCAACCTTAATCCTTGGTCGCCTTTGTGGCGGAATTTCAGCAGCTATCCTATACACCGCCTTCGAACCGTGG
CTAGTCTCCTCTGCATCATCAATGGGCCAATCATCAGAAGACCTATCAACCATCATCAGTCATGCGACGCTTGTC
AATGGCTTCGTAGCTAGTGGTGCCGGAATTATTAGCAACAAGCTTGTCGCAACGACAATCGACTTCACATCTCCT
TTGGTCGTAAGCGGGTTCCTGCTCGTGCTGGGATTTTTTGTTATTCTCAAAACGTGGTCGGAAAATTACGGCGAT
GGAGGCAGGTCCACAACTACCGTCCTTTCTCAAACTGGGAGATTGAGACAGGCATGGAGACTTGTCTGTGAAGAT
CCTGCGCTGTTAACTGTGGGTTTGACCCAGACATGTTTCGAAGGTTCCATGTACTTTTTCGCTTTCATCTGGGTA
CCGTCCCTTCAAGAAGTCTCTCGCTTAAATGACCTCCTTCCATTGGGTTATATCTTCGCTTCATTCATGGTCTCT
ATTACGACCGGTTCCATCCTCTACAATACAATAGTGGCGCGGAGCAAAATCAAAGGAATTTATTCGTCGTTGACT
TTCCATGCAAAATTCAGCAGTGTTATTTGCGCCGTTAGCGCATTAACATTCGCAATTTGTGTCGCTTCGAGTTAC
GAAGATTGGCGATACTTGGCCTTTCTTGTATTCGAAATCTGTGTTGGCATGTATTTTCCTGTGCAAGGCATGCTA
CGGGGAATGTTGATCTCAAAAGATTATCAGGCAACGGTCGTATCTTTGTTCCGCCTCCCGCTTATGCATGCGCCG
TTTTACTTGGCTTATCCTCGCTCATGA
Gene >AgabiH97|110260
ATGGGTAAGCATCTCTTGTATCTGCCAACTGACAGAGTGTCTGATGCCGTCGTGGATTCAGCTGCGTATTGTTTA
CAGGGACCCTACATGTGGTCTTTGTACAGGGTACAATACGGATTACCAGAGAGACTGGTTGCATTACTGTTTGTT
ACTGGTTTTGTGTCTGAGGGTGTAGCGTCTCCCCTTGTGGGTGCCTGGGCGGATCAATAGTCAGTAATCCTCTAA
CTTTCCTACCGCCTGATGGTTGGTAATTGACCTACAATGAACAGCGGTCGACGCAAGCTTTGTCTAGCATTCTGC
GTGATTTCAACTTTTACATGCATCCTAACCTTCCTTCCTAATCTTCCAACCTTAATCCTTGGTCGCCTTTGTGGC
GGAATTTCAGCAGCTATCCTATACACCGCCTTCGAACCGTGGCTAGTCTCCTCTGCATCATCAATGGGCCAATCA
TCAGAAGACCTATCAACCATCATCAGTCATGCGACGCTTGTCAATGGCTTCGTAGCTAGTGGTGCCGGAATTATT
AGCAACAAGCTTGTCGCAACGACAATCGACTTCACATCTCCTTTGGTCGTAAGCGGGTTCCTGCTCGTGCTGGGA
TTTTTTGTTATTCTCAAAACGTGGTCGGAAAATTACGGCGATGGAGGCAGGTCCACAACTACCGTCCTTTCTCAA
ACTGGGAGATTGAGACAGGCATGGAGACTTGTCTGTGAAGGTATGTTCGTTGAAATTTTCGTAATTCAATTCTTA
TAACTTATTTGCGCACTAGATCCTGCGCTGTTAACTGTGGGTTTGACCCAGACATGTTTCGAAGGTTCCATGTAC
TTTTTCGCTTTCATCTGGGTACCGTCCCTTCAAGAAGTCTCTCGCTTAAATGACCTCCTTCCATTGGGTTATATC
TTCGCTTCATTCATGGTCTCTATTACGACCGGTTCCATCCTCTACAATACAATAGTGGCGCGGAGCAAAATCAAA
GGAATTTATTCGTCGTTGACTTTCCATGCAAAATTCAGCAGTGTTATTTGCGCCGTTAGCGCATTAACATTCGCA
ATTTGTGTCGCTTCGAGTTACGAAGATTGGCGATACTTGGCCTTTCTTGTATTCGAAATCTGTGTTGGCATGTAT
TTTCCTGTGCAAGGCATGCTACGGGGAATGTTGATCTCAAAAGATTATCAGGCAACGGTAAATAAGAATTTTTTA
CGCATAAAAAATAGTAGGATGTTGATAGTTTCTTTATCCAGGTCGTATCTTTGTTCCGCCTCCCGCTTAGTATGT
TCGTTGTGATCTCACTCATGGCAGGTGTTTCACCAACTCGACAAACCGTGCTTAGTGCATGCGCCGTTTTACTTG
GCTTATCCTCGCTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail