Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|109980
Gene name
Locationscaffold_8:954573..958677
Strand-
Gene length (bp)4104
Transcript length (bp)3090
Coding sequence length (bp)3090
Protein length (aa) 1030

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 9.7E-28 82 446
PF07993 NAD_binding_4 Male sterility protein 1.8E-14 729 912

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 194 996 9.0E-13
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 726 967 1.0E-11
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 726 1028 6.0E-11
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 740 965 7.0E-11
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 740 1025 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 194 996 9.0E-13
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 726 967 1.0E-11
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 726 1028 6.0E-11
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 740 965 7.0E-11
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 740 1025 3.0E-10
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 722 967 5.0E-10
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 726 967 2.0E-09
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 726 967 2.0E-09
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 729 967 3.0E-09
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 726 967 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 18.89 10.54 27.24
Initials Initials knots 32.02 19.24 44.80
Pileal_Stipeal_center Stage I stipe center 8.38 4.56 12.19
Pileal_Stipeal_shell Stage I stipe shell 6.74 3.54 9.95
DIF_stipe_center Stage II stipe center 7.29 3.92 10.67
DIF_stipe_shell Stage II stipe shell 5.99 3.13 8.85
DIF_stipe_skin Stage II stipe skin 8.58 4.70 12.46
DIF_cap_skin Stage II cap skin 5.03 2.57 7.50
DIF_cap_tissue Stage II cap tissue 4.67 2.36 6.98
DIF_gill_tissue Stage II gill tissue 5.51 2.84 8.19
YFB_stipe_center Young fruiting body stipe center 11.61 6.56 16.66
YFB_stipe_shell Young fruiting body stipe shell 9.11 5.04 13.19
YFB_stipe_skin Young fruiting body stipe skin 9.77 5.42 14.13
YFB_cap_skin Young fruiting body cap skin 6.43 3.40 9.47
YFB_cap_tissue Young fruiting body cap tissue 4.38 2.20 6.57
YFB_gill_tissue Young fruiting body gill tissue 9.27 5.01 13.54
YFB_veil Young fruiting body veil 6.85 3.63 10.08

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.110708 no
Casing YFB_stipe_shell 0.011659 yes
Casing YFB_stipe_skin 0.021846 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.014668 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.064520 no
Casing Pileal_Stipeal_center 0.003365 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.003765 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.011659 yes
DIF_gill_tissue YFB_stipe_shell 0.128227 no
DIF_gill_tissue YFB_stipe_skin 0.070862 no
DIF_gill_tissue YFB_cap_skin 0.770622 no
DIF_gill_tissue YFB_cap_tissue 0.628854 no
DIF_gill_tissue YFB_gill_tissue 0.117172 no
DIF_gill_tissue YFB_veil 0.646085 no
YFB_stipe_center YFB_stipe_shell 0.535021 no
YFB_stipe_center YFB_stipe_skin 0.697604 no
YFB_stipe_center YFB_cap_skin 0.050294 no
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.583503 no
YFB_stipe_center YFB_veil 0.090829 no
YFB_stipe_shell YFB_stipe_skin 0.903942 no
YFB_stipe_shell YFB_cap_skin 0.346165 no
YFB_stipe_shell YFB_cap_tissue 0.020523 yes
YFB_stipe_shell YFB_gill_tissue 0.979465 no
YFB_stipe_shell YFB_veil 0.479928 no
YFB_stipe_skin YFB_cap_skin 0.222361 no
YFB_stipe_skin YFB_cap_tissue 0.010728 yes
YFB_stipe_skin YFB_gill_tissue 0.928947 no
YFB_stipe_skin YFB_veil 0.330557 no
YFB_cap_skin YFB_cap_tissue 0.314783 no
YFB_cap_skin YFB_gill_tissue 0.316965 no
YFB_cap_skin YFB_veil 0.917097 no
YFB_cap_tissue YFB_gill_tissue 0.017783 yes
YFB_cap_tissue YFB_veil 0.230239 no
YFB_gill_tissue YFB_veil 0.443652 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.243427 no
Pileal_Stipeal_center YFB_stipe_center 0.357118 no
Pileal_Stipeal_center YFB_stipe_shell 0.879025 no
Pileal_Stipeal_center YFB_stipe_skin 0.745606 no
Pileal_Stipeal_center YFB_cap_skin 0.526884 no
Pileal_Stipeal_center YFB_cap_tissue 0.043339 yes
Pileal_Stipeal_center YFB_gill_tissue 0.851498 no
Pileal_Stipeal_center YFB_veil 0.660312 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.617680 no
Pileal_Stipeal_center DIF_stipe_center 0.779075 no
Pileal_Stipeal_center DIF_stipe_shell 0.373907 no
Pileal_Stipeal_center DIF_stipe_skin 0.969283 no
Pileal_Stipeal_center DIF_cap_skin 0.120521 no
Pileal_Stipeal_center DIF_cap_tissue 0.061277 no
Pileal_Stipeal_shell DIF_gill_tissue 0.672474 no
Pileal_Stipeal_shell YFB_stipe_center 0.081406 no
Pileal_Stipeal_shell YFB_stipe_shell 0.435221 no
Pileal_Stipeal_shell YFB_stipe_skin 0.295810 no
Pileal_Stipeal_shell YFB_cap_skin 0.940968 no
Pileal_Stipeal_shell YFB_cap_tissue 0.237992 no
Pileal_Stipeal_shell YFB_gill_tissue 0.404363 no
Pileal_Stipeal_shell YFB_veil 0.979465 no
Pileal_Stipeal_shell DIF_stipe_center 0.892119 no
Pileal_Stipeal_shell DIF_stipe_shell 0.829610 no
Pileal_Stipeal_shell DIF_stipe_skin 0.564413 no
Pileal_Stipeal_shell DIF_cap_skin 0.479466 no
Pileal_Stipeal_shell DIF_cap_tissue 0.321805 no
DIF_stipe_center DIF_gill_tissue 0.499736 no
DIF_stipe_center YFB_stipe_center 0.140421 no
DIF_stipe_center YFB_stipe_shell 0.596653 no
DIF_stipe_center YFB_stipe_skin 0.439451 no
DIF_stipe_center YFB_cap_skin 0.815469 no
DIF_stipe_center YFB_cap_tissue 0.139707 no
DIF_stipe_center YFB_gill_tissue 0.562644 no
DIF_stipe_center YFB_veil 0.919948 no
DIF_stipe_center DIF_stipe_shell 0.669366 no
DIF_stipe_center DIF_stipe_skin 0.732702 no
DIF_stipe_center DIF_cap_skin 0.316325 no
DIF_stipe_center DIF_cap_tissue 0.190735 no
DIF_stipe_shell DIF_gill_tissue 0.888350 no
DIF_stipe_shell YFB_stipe_center 0.022369 yes
DIF_stipe_shell YFB_stipe_shell 0.220104 no
DIF_stipe_shell YFB_stipe_skin 0.131110 no
DIF_stipe_shell YFB_cap_skin 0.906344 no
DIF_stipe_shell YFB_cap_tissue 0.442612 no
DIF_stipe_shell YFB_gill_tissue 0.204585 no
DIF_stipe_shell YFB_veil 0.798726 no
DIF_stipe_shell DIF_stipe_skin 0.319789 no
DIF_stipe_shell DIF_cap_skin 0.724980 no
DIF_stipe_shell DIF_cap_tissue 0.562815 no
DIF_stipe_skin DIF_gill_tissue 0.204585 no
DIF_stipe_skin YFB_stipe_center 0.396580 no
DIF_stipe_skin YFB_stipe_shell 0.918414 no
DIF_stipe_skin YFB_stipe_skin 0.791203 no
DIF_stipe_skin YFB_cap_skin 0.463307 no
DIF_stipe_skin YFB_cap_tissue 0.034837 yes
DIF_stipe_skin YFB_gill_tissue 0.892903 no
DIF_stipe_skin YFB_veil 0.605585 no
DIF_stipe_skin DIF_cap_skin 0.100411 no
DIF_stipe_skin DIF_cap_tissue 0.045911 yes
DIF_cap_skin DIF_gill_tissue 0.879378 no
DIF_cap_skin YFB_stipe_center 0.005302 yes
DIF_cap_skin YFB_stipe_shell 0.061662 no
DIF_cap_skin YFB_stipe_skin 0.029408 yes
DIF_cap_skin YFB_cap_skin 0.583742 no
DIF_cap_skin YFB_cap_tissue 0.802516 no
DIF_cap_skin YFB_gill_tissue 0.057155 no
DIF_cap_skin YFB_veil 0.455567 no
DIF_cap_skin DIF_cap_tissue 0.903942 no
DIF_cap_tissue DIF_gill_tissue 0.746161 no
DIF_cap_tissue YFB_stipe_center 0.001625 yes
DIF_cap_tissue YFB_stipe_shell 0.028918 yes
DIF_cap_tissue YFB_stipe_skin 0.015529 yes
DIF_cap_tissue YFB_cap_skin 0.422001 no
DIF_cap_tissue YFB_cap_tissue 0.921281 no
DIF_cap_tissue YFB_gill_tissue 0.026215 yes
DIF_cap_tissue YFB_veil 0.304208 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|109980
MVDVTSLPTLQGAKSTTFTRPPFNDSLTLAEIYAFHALNSSKHPVFTYAENSTKGTREICYSEAYAAIQRGHGMA
SRYHSDLVGDVTRAPVVGILASLDTITYTTFTVGIIHAGLTPFPISTRNSIVGVAHLIRTTGLHLLFVSPDSAMQ
RIALEATAILEKEGIIVKILPVPQFDDLYNEDDTFKQLVPVRISADPIILILHSSGSTAQPKPISMLNSNFVSWS
RVPYYGEIDLAGLPIAAHSLPFFHAMGIGQISWSVGAGSVTACFKPTNPPTIPTPEVFLRELVQTKSKIVFCVPM
FIEAWARSPENIPILRNLSAIVYGGAPMNRAVGDKLVTAGVNLIPFYGSTEAGSLSAVVPKSTTVEHWRYFKFSG
HFKAHITSSHMVDGEEVGELVVLGDKNYNSHVLNTTVEGQRGYATSDLLARHPTEKDRYCVYGRVDDQLVLSTGE
KTNPVPLENIFIQDKNIATAIMFGHGRFQNGVLVQPAEPFDPADETKFIAFKNLIWPTVEKVNDFAPAHSRIFKE
MIITTNSNKPLEFTPKGTPRRQVCLKIYEKEIEAIYEAVKDSSQTDIPVPEVWTVENAMEFVDRTIKRVMKYPIA
ADQDIFLQGCDSLQTTWIRNSLLRAIRLSKNKANVHQIPPNFVYAHPSIQELGGYFWKVLTDNHDTSEESHATQI
ETRRLEMESLVTRYTAEISTPKWKTSLEPRREETILLTGSTGRLGCYCISLDSDALKKIVYLEYDPSKDKLGLTE
DTYSKLQNSVTTIVYNGWRVDFNVGLGSFSYLIAGTRHLLDLAIGSSVCNGPKFVFISSISVFKNALSDRMAPES
PVPASSAAGFGYAEGKWVAESVCQRISEATGLVSSIVRVGQLSGDSDGRWNVKEWVPALIKIGKAIGSLPSRDES
VLWLPADAAAIAILDIVQHPNSPSSPVAYLNLVHPRSTPWDDLFGAAANYLQLDFISYDKWVELLGQKKMIFANG
DHEASADLAGFLSGGQLGSGTFSMDDTLEICPSLRRVKALEGVDLIKSLGFWNF*
Coding >AgabiH97|109980
ATGGTTGATGTTACCTCACTACCCACCCTACAGGGAGCGAAGAGCACTACATTTACACGCCCTCCTTTTAACGAT
TCTTTGACGCTAGCTGAAATCTACGCTTTCCACGCTTTGAACAGCTCGAAACATCCGGTCTTCACTTATGCTGAA
AATTCTACGAAAGGTACTCGCGAAATATGTTATTCAGAAGCATACGCGGCTATTCAAAGAGGCCATGGGATGGCA
TCCCGCTATCATTCTGATCTAGTTGGTGATGTAACAAGAGCTCCTGTCGTTGGCATACTGGCCAGTCTTGATACC
ATCACTTACACCACTTTTACCGTCGGTATCATCCATGCGGGACTCACCCCCTTTCCAATCTCTACACGCAATTCT
ATTGTTGGTGTTGCACACTTGATACGAACCACTGGTTTACACCTCCTCTTCGTGAGCCCGGATTCAGCGATGCAG
CGCATTGCACTCGAAGCCACTGCGATTTTGGAGAAAGAAGGAATCATCGTCAAGATCTTACCCGTACCGCAGTTT
GACGACCTTTACAATGAGGATGATACATTTAAACAATTGGTTCCTGTACGTATCTCGGCGGATCCTATCATCCTT
ATATTACACTCCTCTGGTTCTACAGCTCAGCCTAAACCCATTTCAATGCTCAATAGTAATTTTGTTTCATGGAGT
CGTGTGCCTTATTATGGAGAAATAGATCTCGCTGGCTTGCCGATTGCTGCTCATTCTTTACCATTTTTCCATGCC
ATGGGGATCGGTCAGATATCATGGAGCGTCGGTGCAGGCAGTGTAACAGCTTGCTTCAAACCAACGAATCCTCCT
ACTATTCCTACACCCGAAGTATTTCTACGCGAACTCGTTCAAACGAAATCTAAAATAGTATTTTGTGTGCCAATG
TTCATTGAGGCATGGGCGCGTTCTCCTGAAAACATTCCTATTCTTCGTAACTTGAGCGCAATAGTATATGGTGGG
GCTCCAATGAATCGGGCGGTTGGGGACAAACTTGTCACTGCTGGTGTCAACCTTATTCCCTTCTACGGATCTACA
GAAGCCGGGTCTCTGAGCGCAGTTGTTCCGAAGTCGACAACCGTAGAACATTGGCGATACTTCAAGTTTTCAGGT
CATTTCAAAGCTCATATTACGTCCTCGCACATGGTTGATGGGGAAGAGGTAGGAGAGTTGGTGGTCCTTGGGGAT
AAAAATTACAATTCGCATGTCCTGAACACCACGGTCGAAGGACAACGAGGTTATGCTACTAGTGACTTACTTGCA
CGCCATCCTACTGAAAAGGATAGATATTGCGTATATGGAAGAGTCGACGATCAGCTAGTTTTGTCCACTGGCGAA
AAGACAAATCCCGTGCCATTAGAAAATATCTTCATCCAGGATAAAAACATTGCTACTGCAATCATGTTCGGTCAC
GGTCGCTTCCAAAATGGAGTCCTTGTCCAACCTGCTGAACCCTTCGATCCTGCTGATGAGACGAAATTCATCGCC
TTCAAAAATTTGATTTGGCCAACTGTTGAAAAGGTCAATGACTTCGCTCCCGCACACTCTCGGATTTTCAAGGAG
ATGATCATCACCACCAACTCAAATAAACCGCTTGAATTTACGCCCAAAGGAACACCGCGACGGCAAGTCTGCTTG
AAGATTTATGAAAAGGAGATCGAGGCCATATACGAGGCCGTGAAAGATTCTTCTCAGACAGATATCCCAGTTCCC
GAAGTTTGGACTGTGGAGAACGCGATGGAATTTGTTGATAGAACAATTAAGAGAGTCATGAAGTATCCGATCGCT
GCGGACCAGGACATCTTTTTACAAGGATGCGACAGCTTGCAGACAACCTGGATTAGAAACAGTCTGCTGCGCGCT
ATTCGCTTGTCGAAGAACAAGGCGAATGTCCATCAAATTCCACCCAATTTTGTATATGCACACCCAAGTATACAG
GAGCTCGGAGGTTATTTCTGGAAAGTCCTAACGGATAATCACGATACCAGCGAAGAGAGTCACGCTACTCAAATC
GAAACAAGACGCCTTGAGATGGAATCCCTCGTCACCAGATATACCGCAGAGATATCAACACCGAAGTGGAAAACC
TCACTCGAACCGCGTCGCGAAGAAACGATCCTGCTCACTGGTAGTACAGGTCGACTTGGTTGCTATTGTATTAGC
TTGGATTCGGATGCTTTGAAAAAGATAGTATATTTGGAATACGATCCATCAAAGGATAAACTAGGTTTGACGGAA
GACACTTATTCCAAGCTTCAAAACTCGGTTACGACTATCGTCTACAACGGCTGGCGGGTCGACTTCAACGTCGGG
TTGGGATCATTCAGCTACTTGATTGCTGGCACGCGTCACCTCCTAGACCTGGCCATAGGTTCCTCGGTGTGTAAC
GGGCCAAAGTTTGTCTTCATCAGCTCGATATCCGTATTTAAAAATGCGTTGTCCGATCGAATGGCACCCGAGTCT
CCGGTCCCAGCGTCATCAGCAGCTGGCTTTGGTTACGCTGAGGGAAAATGGGTTGCGGAGAGCGTTTGTCAGAGA
ATCAGTGAAGCCACTGGATTGGTTTCGTCAATCGTCCGTGTTGGACAGTTGAGTGGAGACTCTGATGGACGCTGG
AACGTGAAGGAATGGGTGCCGGCCCTTATCAAGATTGGAAAGGCCATTGGAAGCCTTCCTTCTCGCGACGAGTCC
GTGTTATGGCTTCCTGCTGATGCTGCAGCAATTGCCATTCTTGACATCGTCCAGCATCCTAATAGCCCTTCATCG
CCTGTTGCATATCTGAATTTGGTCCACCCACGATCTACCCCTTGGGATGACTTGTTTGGAGCTGCGGCTAATTAT
TTGCAGCTTGATTTCATCTCATATGATAAATGGGTGGAGCTCCTTGGTCAAAAGAAAATGATATTTGCCAACGGA
GACCACGAAGCGTCGGCCGATTTGGCAGGATTTTTATCAGGAGGTCAGCTGGGAAGTGGTACATTCAGTATGGAT
GACACATTGGAAATTTGTCCAAGTCTAAGACGTGTCAAAGCGCTGGAAGGAGTAGATCTGATAAAATCCTTAGGC
TTCTGGAATTTCTAG
Transcript >AgabiH97|109980
ATGGTTGATGTTACCTCACTACCCACCCTACAGGGAGCGAAGAGCACTACATTTACACGCCCTCCTTTTAACGAT
TCTTTGACGCTAGCTGAAATCTACGCTTTCCACGCTTTGAACAGCTCGAAACATCCGGTCTTCACTTATGCTGAA
AATTCTACGAAAGGTACTCGCGAAATATGTTATTCAGAAGCATACGCGGCTATTCAAAGAGGCCATGGGATGGCA
TCCCGCTATCATTCTGATCTAGTTGGTGATGTAACAAGAGCTCCTGTCGTTGGCATACTGGCCAGTCTTGATACC
ATCACTTACACCACTTTTACCGTCGGTATCATCCATGCGGGACTCACCCCCTTTCCAATCTCTACACGCAATTCT
ATTGTTGGTGTTGCACACTTGATACGAACCACTGGTTTACACCTCCTCTTCGTGAGCCCGGATTCAGCGATGCAG
CGCATTGCACTCGAAGCCACTGCGATTTTGGAGAAAGAAGGAATCATCGTCAAGATCTTACCCGTACCGCAGTTT
GACGACCTTTACAATGAGGATGATACATTTAAACAATTGGTTCCTGTACGTATCTCGGCGGATCCTATCATCCTT
ATATTACACTCCTCTGGTTCTACAGCTCAGCCTAAACCCATTTCAATGCTCAATAGTAATTTTGTTTCATGGAGT
CGTGTGCCTTATTATGGAGAAATAGATCTCGCTGGCTTGCCGATTGCTGCTCATTCTTTACCATTTTTCCATGCC
ATGGGGATCGGTCAGATATCATGGAGCGTCGGTGCAGGCAGTGTAACAGCTTGCTTCAAACCAACGAATCCTCCT
ACTATTCCTACACCCGAAGTATTTCTACGCGAACTCGTTCAAACGAAATCTAAAATAGTATTTTGTGTGCCAATG
TTCATTGAGGCATGGGCGCGTTCTCCTGAAAACATTCCTATTCTTCGTAACTTGAGCGCAATAGTATATGGTGGG
GCTCCAATGAATCGGGCGGTTGGGGACAAACTTGTCACTGCTGGTGTCAACCTTATTCCCTTCTACGGATCTACA
GAAGCCGGGTCTCTGAGCGCAGTTGTTCCGAAGTCGACAACCGTAGAACATTGGCGATACTTCAAGTTTTCAGGT
CATTTCAAAGCTCATATTACGTCCTCGCACATGGTTGATGGGGAAGAGGTAGGAGAGTTGGTGGTCCTTGGGGAT
AAAAATTACAATTCGCATGTCCTGAACACCACGGTCGAAGGACAACGAGGTTATGCTACTAGTGACTTACTTGCA
CGCCATCCTACTGAAAAGGATAGATATTGCGTATATGGAAGAGTCGACGATCAGCTAGTTTTGTCCACTGGCGAA
AAGACAAATCCCGTGCCATTAGAAAATATCTTCATCCAGGATAAAAACATTGCTACTGCAATCATGTTCGGTCAC
GGTCGCTTCCAAAATGGAGTCCTTGTCCAACCTGCTGAACCCTTCGATCCTGCTGATGAGACGAAATTCATCGCC
TTCAAAAATTTGATTTGGCCAACTGTTGAAAAGGTCAATGACTTCGCTCCCGCACACTCTCGGATTTTCAAGGAG
ATGATCATCACCACCAACTCAAATAAACCGCTTGAATTTACGCCCAAAGGAACACCGCGACGGCAAGTCTGCTTG
AAGATTTATGAAAAGGAGATCGAGGCCATATACGAGGCCGTGAAAGATTCTTCTCAGACAGATATCCCAGTTCCC
GAAGTTTGGACTGTGGAGAACGCGATGGAATTTGTTGATAGAACAATTAAGAGAGTCATGAAGTATCCGATCGCT
GCGGACCAGGACATCTTTTTACAAGGATGCGACAGCTTGCAGACAACCTGGATTAGAAACAGTCTGCTGCGCGCT
ATTCGCTTGTCGAAGAACAAGGCGAATGTCCATCAAATTCCACCCAATTTTGTATATGCACACCCAAGTATACAG
GAGCTCGGAGGTTATTTCTGGAAAGTCCTAACGGATAATCACGATACCAGCGAAGAGAGTCACGCTACTCAAATC
GAAACAAGACGCCTTGAGATGGAATCCCTCGTCACCAGATATACCGCAGAGATATCAACACCGAAGTGGAAAACC
TCACTCGAACCGCGTCGCGAAGAAACGATCCTGCTCACTGGTAGTACAGGTCGACTTGGTTGCTATTGTATTAGC
TTGGATTCGGATGCTTTGAAAAAGATAGTATATTTGGAATACGATCCATCAAAGGATAAACTAGGTTTGACGGAA
GACACTTATTCCAAGCTTCAAAACTCGGTTACGACTATCGTCTACAACGGCTGGCGGGTCGACTTCAACGTCGGG
TTGGGATCATTCAGCTACTTGATTGCTGGCACGCGTCACCTCCTAGACCTGGCCATAGGTTCCTCGGTGTGTAAC
GGGCCAAAGTTTGTCTTCATCAGCTCGATATCCGTATTTAAAAATGCGTTGTCCGATCGAATGGCACCCGAGTCT
CCGGTCCCAGCGTCATCAGCAGCTGGCTTTGGTTACGCTGAGGGAAAATGGGTTGCGGAGAGCGTTTGTCAGAGA
ATCAGTGAAGCCACTGGATTGGTTTCGTCAATCGTCCGTGTTGGACAGTTGAGTGGAGACTCTGATGGACGCTGG
AACGTGAAGGAATGGGTGCCGGCCCTTATCAAGATTGGAAAGGCCATTGGAAGCCTTCCTTCTCGCGACGAGTCC
GTGTTATGGCTTCCTGCTGATGCTGCAGCAATTGCCATTCTTGACATCGTCCAGCATCCTAATAGCCCTTCATCG
CCTGTTGCATATCTGAATTTGGTCCACCCACGATCTACCCCTTGGGATGACTTGTTTGGAGCTGCGGCTAATTAT
TTGCAGCTTGATTTCATCTCATATGATAAATGGGTGGAGCTCCTTGGTCAAAAGAAAATGATATTTGCCAACGGA
GACCACGAAGCGTCGGCCGATTTGGCAGGATTTTTATCAGGAGGTCAGCTGGGAAGTGGTACATTCAGTATGGAT
GACACATTGGAAATTTGTCCAAGTCTAAGACGTGTCAAAGCGCTGGAAGGAGTAGATCTGATAAAATCCTTAGGC
TTCTGGAATTTCTAG
Gene >AgabiH97|109980
ATGGTTGATGTTACCTCACTACCCACCCTACAGGGAGCGAAGAGCACTACATTTACACGCCCTCCTTTTAACGAT
TCTTTGACGCTAGCTGAAATCTACGCTTTCCACGCTTTGAACAGCTCGAAACATCCGGTCTTCACTTATGCTGAA
AATTCTACGAAAGGTACTCGCGAAATATGTTATTCAGAAGCATACGCGGCTATTCAAAGAGGCCATGGGATGGCA
TCCCGCTATCATTCTGATCTAGTTGGTGATGTAACAAGAGCTCCTGTCGTTGGCATACTGGCCAGTCTTGGTAGG
CAACACATTGGAATTTTGATACAAACGCGACTCAATATTGCATCAGATACCATCACTTACACCACTTTTACCGTC
GGTATCATCCATGCGGGACTCACCCCCTTTCCAATCTCTACACGCAATTCTATTGTTGGTGTTGCACACTTGATA
CGAACCACTGGTTTACACCTCCTCTTCGTGAGCCCGGATTCAGCGATGCAGCGCATTGCACTCGAAGCCACTGCG
ATTTTGGAGAAAGAAGGAATCATCGTCAAGATCTTACCCGTACCGCAGTTTGACGACCTTTACAATGAGGATGAT
ACATTTAAACAATTGGTTCCTGTACGTATCTCGGCGGATCCTATCATCCTTATATTACACTCCTCTGGTATGTTT
GGTTCTCATGCTCGGTGAATGCTCCGCCCATCTTTCTTGATAGGTTCTACAGCTCAGCCTAAACCCATTTCAATG
CTCAATAGTAATTTTGTTTCATGGAGTCGTGTGCCTTGTATGTCAATCATTACTGTTCTTCGTATAAGCTGAATT
CGAGTCTTTAAGATTATGGAGAAATAGATCTCGCTGGCTTGCCGATTGCTGCTCATTCTTTACCATTTTTCCGTT
AGTATTTCCTTTCACCTTGAGTGTAATCAGACTCAGTTTATATAGATGCCATGGGGATCGGTCAGATATCATGGA
GCGTAAGTCGCTCGTTTACCTGTGCTGACATTTCATTGACTTCGTAAAAGGTCGGTGCAGGCAGTGTAACAGCTT
GCTTCAAACCAACGAATCCTCCTACTATTCCTACACCCGAAGTATTTCTACGCGAACTCGTTCAAACGAAATCTA
AAATAGTATTTTGTGTGCCAATGTTCATTGAGGTGATTTGATAACTCCGGGGTATGTCATTTTGACTAACTTACC
CAGGCATGGGCGCGTTCTCCTGAAAACATTCCTATTCTTCGTAACTTGAGCGCAATAGTTAGCTTTCGCCCTTTC
TTGTAGATGATTTGATTTACGAAGCGTAGGTATATGGTGGGGCTCCAATGAATCGGGCGGTTGGGGACAAACTTG
TCACTGCTGGTGTCAACCTTATTCCCTTCTACGGATCGTAAGTACGATGACTCTATTGTCGACTATCCTGAAATT
CTATTCAAGTACAGAAGCCGGGTCTCTGAGCGCAGTTGTTCCGAAGTCGACAACCGTAGAACATTGGCGATACTT
CAAGTTTTCAGGTCATTTCAAAGCTCATATTACGTCCTCGCACATGGTTGATGGGGAAGAGGTAGGAGAGTTGGT
GGTCCTTGTATGTCCGTTTTCCCGCGACCATTTCACCGCTAATTCTACTGAACCAAGGGGGATAAAAATTACAAT
TCGCATGTCCTGAACACCACGGTCGAAGGACAACGAGGTTATGCTACTAGTGACTTACTTGCACGCCATCCTACT
GAAAAGGATAGATATTGCGTATATGGAAGAGTCGACGATCAGCTAGTTTTGTCCACTGGCGAAAAGGTGATGCTC
CTTGATAACATTAATATTCAATAGCGACACATCTAATCAGCATAGCAGACAAATCCCGTGCCATTAGGTATCCGA
ATAAAATTTCAGACCATACTTTGGAGTTGCTGACAAACAGCAGAAAATATCTTCATCCAGGATAAAAACATTGCT
ACTGCAATCATGTTCGGTCACGGTCGCTTCCAAAATGGAGTCCTTGTCCAACCTGCTGAACCCTTCGATCCTGCT
GATGAGACGAAATTCATCGCCTTCAAAAATTTGATTTGGTATTTCTTATGATTATTAGCTGTTGACAATAAGCCT
GACTTTCCACCGACAGGCCAACTGTTGAAAAGGTCAATGACTTCGCTCCCGCACACTCTCGGATTTTCAAGGAGG
TACGTCGAATGAACATACTTCGCCATCCAATATAATTAAGCCCCATGCAGATGATCATCACCACCAACTCAAATA
AACCGCTTGAATTTACGCCCAAAGGAACACCGCGACGGCAAGTCTGCTTGAAGATTTATGAAAAGGAGATCGAGG
CCATATACGAGGCCGTGAAAGATTCTTCTCAGACAGATATCCCAGTTCCCGAAGTTTGGACTGTGGAGAACGCGA
TGGAATTTGTTGATAGAACAATTAAGAGAGTCATGAAGTATCCGATCGCTGCGGACCAGGACATCTTTTTACAAG
GATGCGACAGGTTTGTCCAACCCTTTTTGTATACCGTCTCCTTCTAATATCTGTTTTAAGCTTGCAGACAACCTG
GATTAGAAACAGTCTGCTGCGCGCTATTCGCTTGTCGAAGAACAAGGCGAATGTCCATCAAATTCCACCCAATTT
TGTATATGCACACCCAAGTATACAGGAGCTCGGAGGTTATTTCTGGAAAGTCCTAACGGATAATCACGATACCAG
CGAAGAGAGTCACGCTACTCAAATCGAAACAAGACGCCTTGAGATGGAATCCCTCGTCACCAGATATACCGCAGA
GATATCAACACCGAAGTGGAAAACCTCACTCGAACCGCGTCGCGAAGAAACGATCCTGCTCACTGGTAGTACAGG
TCGACTTGGTTGCTATGTCCTCAAGCAACTAGCCGAAAACGAAAGTATAGTCAAGGTGTATGCGCTTAACCGAGC
GAGTGTATTAGGTCTGTCAGCAGAATATAAGCAAAAAGAGGCACTCAAACTTTGGGGTACCAGCTTGGATTCGGA
TGCTTTGAAAAAGATAGTATATTTGGAATACGATCCATCAAAGGATAAACTAGGTTTGACGGAAGACACTTATTC
CAAGGTAGGAGTGACTGCCCTTGAGACCCTTTTCACATTTAACATAAACTTACAGCTTCAAAACTCGGTTACGAC
TATCGTCTACAACGGTTGGACTTGTCTTATCATCAGTTTCCTGGGAACTGATTGACATCCTAGGCTGGCGGGTCG
ACTTCAACGTCGGGTTGGGATCATTCAGCTACTTGATTGCTGGCACGCGTCACCTCCTAGACCTGGCCATAGGTT
CCTCGGTGTGTAACGGGCCAAAGTTTGTCTTCATCAGCTCGATATCCGTATTTAAAAGTATGTCGTTCCAGGCCT
TGACATGATACGTGAGCTTATAGTGATCAGATGCGTTGTCCGATCGAATGGCACCCGAGTCTCCGGTCCCAGCGT
CATCAGCAGCTGGCTTTGGTTACGCTGAGGGAAAATGGGTTGCGGAGAGCGTTTGTCAGAGAATCAGTGAAGCCA
CTGGATTGGTTTCGTCAATCGTCCGTGTTGGACAGTTGAGTGGAGACTCTGATGGACGCTGGAACGTGAAGGAAT
GGGTGCCGGCCCTTATCAAGATTGGAAAGGCCATTGGAAGCCTTCCTTCTCGCGACGAGGTAAACTTTTCCGGCG
TTTGCCTCGGTTACACCGCTGACAGTTATTCTTCAGTCCGTGTTATGGCTTCCTGCTGATGCTGCAGCAATTGCC
ATTCTTGACATCGTCCAGCATCCTAATAGCCCTTCATCGCCTGTTGCATATCTGAATTTGGTCCACCCACGATCT
ACCCCTTGGGATGACTTGTTTGGAGCTGCGGCTAATTATTTGCAGCTTGATTTCATCTCATATGATAAATGGGTG
GAGCTCCTTGGTCAAAAGAAAATGATATTTGCCAACGGAGACCACGAAGCGTCGGCCGATTTGGCAGGATTTTTA
TCAGGAGGTCAGCTGGGAAGTGGTACATTCAGTATGGATGACACATTGGAAATTTGTCCAAGTCTAAGACGTGTC
AAAGCGCTGGAAGGAGTAGATCTGATAAAATCCTTAGGCTTCTGGAATTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail