Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|109870
Gene name
Locationscaffold_8:922489..928543
Strand-
Gene length (bp)6054
Transcript length (bp)5637
Coding sequence length (bp)5637
Protein length (aa) 1879

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12814 Mcp5_PH Meiotic cell cortex C-terminal pleckstrin homology 2.6E-46 1510 1627
PF00169 PH PH domain 1.2E-05 1532 1626

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q00083|APSA_EMENI Anucleate primary sterigmata protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=apsA PE=1 SV=2 1500 1797 4.0E-45
sp|Q00402|NUM1_YEAST Nuclear migration protein NUM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUM1 PE=1 SV=2 1500 1676 2.0E-35
sp|Q00083|APSA_EMENI Anucleate primary sterigmata protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=apsA PE=1 SV=2 22 244 1.0E-13
sp|Q9Y7J9|MCP5_SCHPO Meiotic coiled-coil protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcp5 PE=1 SV=1 1486 1623 5.0E-08
sp|Q96KM6|Z512B_HUMAN Zinc finger protein 512B OS=Homo sapiens GN=ZNF512B PE=1 SV=1 993 1161 3.0E-06

GO

GO Term Description Terminal node
GO:0032065 maintenance of protein location in cell cortex Yes
GO:0005515 protein binding Yes
GO:0005938 cell cortex Yes
GO:0005543 phospholipid binding Yes
GO:0005737 cytoplasm No
GO:0008289 lipid binding No
GO:0051651 maintenance of location in cell No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0051235 maintenance of location No
GO:0045185 maintenance of protein location No
GO:0005488 binding No
GO:0032507 maintenance of protein location in cell No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|109870
MATHDVRSTDNMLTSEHPDDPFHATTAADLNFYLQGLLDKKEKQLQQAGNLGQRVLAQQMELEERIRQIQESVID
KPDDEEIDHAARSKYQELNEAILSWDTENSQLSSAFGSSSKRYANSNQPSPTTAFAELPSEAPEHKRPSGSAAGQ
SRRAKNAANRSFIDPEFAMDIGNNLLAEIRRLQSLLTERDKAIQDMKEERDDLERTVEALKTALKEQERSSDKYR
EENWNLEVTLQELRSQLADSQSSAVRLETEHKKLSKSLTQTRDQAELHKTESEKHQAAFNDLKSKHESDVAQARK
HAAGLARDKQDLQQTVDTLKLQISRVNRRLPKYGSPLTPGTGDNIKDFITPGTERTDDTGTDIFTGGASTNRRRF
DNSLYPDGFGNEFYDPDTPEDSPIRRPFQTPNTEIEALQQRLAHAQRQINTLKGSLNREKQIRIRLENAAAGSHS
ASQLGSEGEEEEEVEEDETQVEDVAEPSIVSSARGGKPRRGGTAFKVGRGGSGMATRRGRGRGGITLMQRLGLAA
NSPSASSYNDEGEEFSTSPPTSVPSIPINLHQASPPRTEEEEEENFFNSSTSSHTLQQDGMQSNRTSVASVDGMD
PAFANVLKRSSSSSSYSSPLRHSLLSRRGSTRRKGVTAGRRNRGGVPFKEARPPSVINDNPSALAAELGLSPGGE
SEATAEDGANTSSPMKGLTGGVTSPTRSSFLDVEESIREEEEELRAWRKEVVGEGDEDEDEDEEVEEVEMREFGC
QTDPVPDVAKTLVDISVETDSQFSPFATIKGKAWPEGLRRTTITQKDFGSLRSSSSKTISNGDDHTITRSFLRES
HTNDDDAYSEGEETETGADDTETEADYYDARTDMNTPSLSGRASALSTSAFTESRESFHSIMTVSDHEYPSDSGS
ESDESIRASSRPSTGLERRRQEQGQQFGNESKQSLVTRSESVASYYTTSQGPFVSYEDVGVDASVEPEVVVKEVP
VEVIKEVEVVKEVRVEVPVEVIREVEVIKEVEVVKEVVKEVPVEVIKEVPFEVIKEVEVVREVLKEVPVEVIKEV
RVEVPVPVEKDVEIVKEVVKEVLVEVPVPKEVEVVREVRVEVPVEVVKEVIREVEKRVEVIKEVPVEVIREVRVE
VPVEVKVPFEVVKEVVKIVEKPVEVIREVEVIKEVPVEVIRDVVRKVPVEVIREIPAPKCEVREMEIQTDDTMEF
EQSTIMDLSRKQLSSTSVQVSPISGPVFIPPPPTTAPPPSALSRSVSKSGSLVNGSSPTPLLRTGSQHQFQFIPS
NTTTSPTSKSDTAPILLSRASRLSASDRRTSMESGISSLNAGDTSTGSAGNRPQAVLLNAIDKSKPPMMVLPPPP
KAPPPPGSMPPPSFIPDRNRPPPRPLSPPPPELIQRATTPTTFGRGGSMRQLPSTSSFRSAGQYGTVGNQPVERR
QVSNASLAYSGGERSPRSSISSSDGHGLQRGASMMSRPAASDGGQGAGSLPVTPNRTPRAAGMTGGAVNGHQQQQ
QQASGTDPIIIHAITQTMIGEFLWKYTRKAIGKGHGERRHKRFFWVHPYTKTLYWSSSDPGSSNVNESSAKSAYI
EGVRSVLDPNPMPPGLYQYSVVVSTPQREMKITAPTKERHDIWLNALKYLLSRPSASVNNMDDSPPTQQSPADYQ
TDDDPVSPRRRLLSSPQSVRSRSSRRGGTPGDTWSSTPKGKRSRSQLSVKGSVSKRSGTPAAEYLRWNGPESPYS
PSRSFIDEARDDDIVGDGHLDLNFELHDDDELSEGGYEGLENVRACCDGRHTVGHSHPKKHSHPQHQQGHAHTAP
LLTTLTRHSLESQHQQADSNPMDIGRPASPAWSFRSRTGSADGHSSAAGSGSGGLLSKLRFGSKRGPKNTPVLPP
VDQ*
Coding >AgabiH97|109870
ATGGCGACCCACGACGTCCGTAGCACAGACAACATGCTCACCAGCGAGCACCCCGACGATCCTTTCCATGCCACG
ACAGCCGCGGACCTCAATTTTTATCTCCAAGGTCTCCTAGACAAGAAGGAAAAGCAGCTCCAGCAGGCTGGCAAT
CTCGGTCAACGTGTCCTGGCCCAGCAGATGGAGCTCGAAGAGCGCATTAGGCAGATCCAGGAGTCCGTCATCGAT
AAACCAGACGATGAGGAGATAGACCACGCGGCTCGCTCCAAATACCAAGAACTCAACGAGGCCATCCTCAGCTGG
GACACAGAGAACTCCCAGCTGTCGTCTGCCTTTGGTTCCAGCTCAAAGCGCTATGCGAATAGCAATCAACCATCC
CCCACTACTGCTTTTGCAGAACTCCCTAGCGAGGCTCCAGAGCACAAACGGCCTTCGGGCTCCGCAGCAGGCCAA
TCCCGGCGCGCAAAGAATGCGGCAAACCGCTCCTTCATTGATCCCGAATTTGCGATGGACATTGGCAACAACCTT
CTCGCCGAAATTCGTCGGCTTCAGAGTCTTCTCACCGAACGTGACAAGGCTATTCAGGATATGAAAGAAGAGCGA
GATGATCTCGAGAGAACCGTCGAAGCCCTCAAAACTGCGCTCAAAGAGCAAGAACGAAGTTCCGACAAATACCGC
GAAGAGAACTGGAATCTCGAAGTTACCCTTCAAGAACTCCGATCTCAACTTGCAGACTCTCAAAGCTCCGCTGTT
CGTCTAGAGACCGAGCATAAGAAACTCAGCAAATCCCTCACTCAAACCCGAGACCAAGCGGAACTTCATAAAACC
GAATCGGAAAAACATCAGGCTGCCTTCAATGACCTAAAATCGAAACACGAGAGTGACGTTGCTCAGGCCCGTAAA
CATGCAGCAGGTCTCGCCAGAGATAAACAAGATCTCCAACAAACCGTTGATACCCTCAAACTCCAAATTTCACGC
GTCAATCGTCGTTTACCCAAGTACGGTTCACCGCTCACGCCAGGTACAGGAGATAATATAAAGGATTTCATCACT
CCTGGTACGGAACGTACAGATGATACCGGAACAGACATCTTTACCGGAGGAGCCTCGACTAATCGGAGGAGATTC
GACAACTCCTTATACCCCGATGGTTTCGGTAACGAGTTCTATGACCCAGATACCCCCGAAGATTCCCCCATACGT
CGACCTTTTCAAACTCCCAATACCGAAATCGAGGCTTTGCAACAGAGGTTGGCGCATGCGCAGAGACAAATCAAT
ACCCTTAAAGGCTCACTAAATCGGGAGAAGCAAATCCGGATACGCCTTGAAAATGCTGCTGCTGGGTCTCATTCT
GCGTCTCAGCTAGGATCGGAAGGAGAAGAGGAAGAAGAAGTGGAAGAAGATGAAACGCAGGTCGAAGACGTTGCG
GAACCGAGCATCGTTTCTAGTGCGAGAGGCGGTAAACCAAGACGTGGTGGAACAGCGTTCAAGGTCGGCAGAGGA
GGATCTGGTATGGCCACGAGGCGCGGAAGGGGAAGAGGTGGAATTACTCTTATGCAGAGATTGGGTTTGGCAGCC
AATAGCCCTTCAGCGTCCTCCTATAACGACGAAGGGGAAGAATTCTCTACATCTCCCCCTACCTCTGTCCCTTCT
ATCCCCATCAATCTTCACCAAGCATCGCCGCCACGAACGGAAGAGGAGGAGGAAGAGAATTTCTTCAATTCTTCC
ACTTCGAGTCACACACTCCAACAAGATGGAATGCAATCGAACAGAACTTCGGTTGCAAGTGTTGATGGGATGGAC
CCTGCTTTCGCAAATGTGCTTAAACGTTCATCGTCATCATCATCGTACTCGAGCCCTCTTCGACATTCTCTACTT
TCGAGACGTGGCTCTACACGTAGAAAAGGTGTTACTGCGGGAAGGCGGAATCGCGGTGGTGTTCCTTTCAAAGAA
GCTAGACCTCCTTCGGTTATCAATGATAACCCTTCTGCTCTTGCTGCGGAATTGGGATTGTCACCGGGTGGTGAA
AGTGAGGCAACTGCAGAGGACGGAGCGAATACTTCTTCGCCGATGAAGGGACTGACTGGTGGTGTTACTAGTCCG
ACTAGGAGCTCTTTCTTGGACGTTGAGGAGAGTATTAGAGAGGAAGAAGAGGAACTGAGAGCTTGGAGGAAGGAA
GTCGTTGGTGAAGGAGATGAGGATGAGGATGAGGACGAAGAGGTAGAGGAGGTGGAGATGAGGGAGTTTGGATGT
CAAACTGATCCTGTTCCAGATGTTGCCAAGACTTTGGTCGATATTTCTGTTGAGACAGATTCTCAGTTCTCGCCA
TTCGCAACGATAAAAGGAAAAGCATGGCCGGAAGGATTGAGGAGGACGACGATAACTCAAAAGGACTTTGGGTCA
TTGAGGTCTTCTTCGTCCAAGACCATTTCTAATGGAGATGATCACACTATCACTCGATCTTTCCTACGTGAATCT
CATACCAACGACGATGACGCTTATTCGGAAGGAGAAGAAACCGAAACCGGTGCAGACGATACGGAAACTGAAGCC
GACTATTATGATGCTCGTACCGATATGAACACTCCTTCACTTTCAGGTCGTGCGTCAGCACTTTCGACATCTGCA
TTCACAGAATCAAGAGAAAGTTTCCATTCGATTATGACTGTTTCCGATCATGAATATCCGTCTGATTCGGGATCC
GAGTCGGATGAGAGTATTAGAGCTTCGTCTCGTCCTTCTACGGGGTTGGAACGTCGTCGACAAGAACAAGGACAA
CAATTTGGGAATGAGAGTAAGCAGAGTTTGGTTACGAGATCTGAATCGGTGGCTTCGTACTATACGACGAGTCAG
GGGCCGTTTGTTAGTTATGAAGATGTTGGTGTGGATGCGAGTGTTGAGCCTGAGGTTGTTGTGAAGGAAGTGCCG
GTGGAAGTGATTAAAGAAGTTGAAGTCGTGAAAGAGGTCAGGGTGGAAGTTCCTGTGGAGGTCATTAGGGAAGTT
GAAGTGATCAAGGAGGTTGAGGTGGTCAAAGAGGTCGTTAAAGAAGTACCGGTGGAGGTTATTAAAGAGGTGCCG
TTCGAAGTGATTAAGGAGGTCGAGGTTGTGAGGGAAGTGTTGAAAGAAGTTCCTGTGGAGGTTATTAAGGAAGTC
CGAGTTGAGGTTCCTGTTCCTGTTGAAAAGGATGTTGAGATTGTGAAGGAGGTTGTGAAAGAGGTGTTGGTGGAA
GTGCCTGTACCGAAGGAAGTGGAAGTTGTTAGGGAGGTGAGAGTGGAAGTTCCTGTGGAGGTTGTGAAGGAGGTG
ATTAGAGAGGTGGAGAAACGCGTGGAGGTGATCAAAGAAGTACCGGTCGAAGTTATTAGGGAAGTTAGAGTGGAA
GTACCTGTTGAAGTTAAGGTGCCCTTCGAAGTGGTGAAAGAGGTGGTCAAGATCGTCGAAAAACCTGTTGAAGTG
ATTCGAGAAGTCGAAGTCATCAAGGAAGTTCCAGTTGAGGTTATTCGAGACGTTGTCAGAAAAGTGCCTGTCGAA
GTCATTCGAGAAATTCCGGCGCCGAAATGTGAAGTCAGAGAGATGGAAATCCAGACGGATGATACTATGGAGTTT
GAACAATCGACGATTATGGATTTATCGAGAAAGCAGTTGTCTTCGACTTCTGTACAAGTCTCGCCGATTTCTGGA
CCAGTGTTTATTCCACCTCCTCCGACTACCGCTCCTCCTCCCTCGGCACTTTCGAGGTCGGTATCGAAATCCGGA
TCATTGGTAAATGGTTCATCGCCAACTCCATTACTTCGTACCGGAAGTCAACATCAATTCCAATTCATTCCGTCG
AACACGACGACTTCGCCTACCTCCAAATCTGACACAGCACCAATACTGCTTTCGCGCGCCAGCAGACTATCAGCT
TCTGATCGCCGCACATCTATGGAGAGTGGTATATCATCTCTGAATGCTGGCGATACTTCAACTGGGTCTGCTGGC
AATCGACCGCAAGCTGTACTGTTGAATGCTATAGACAAATCGAAACCGCCTATGATGGTACTTCCACCGCCTCCG
AAAGCGCCACCACCACCTGGTAGTATGCCTCCGCCATCATTTATTCCTGATCGTAATCGTCCACCACCGAGACCT
TTGTCCCCTCCTCCGCCAGAATTAATACAACGTGCTACAACACCCACGACATTCGGTAGGGGAGGAAGTATGAGG
CAATTGCCTAGTACAAGTAGCTTCAGATCTGCTGGGCAATATGGAACTGTTGGAAACCAACCGGTTGAAAGGAGA
CAAGTTTCAAATGCTTCTTTGGCTTATTCTGGTGGAGAGAGATCGCCGAGATCATCGATATCGTCGTCGGATGGA
CATGGGTTGCAACGCGGAGCTAGCATGATGAGTAGACCGGCGGCATCGGATGGTGGTCAAGGTGCTGGTAGTCTT
CCTGTGACTCCCAATAGAACTCCTCGTGCGGCTGGAATGACGGGAGGAGCTGTTAATGGCCATCAACAGCAACAA
CAACAGGCGTCGGGAACGGATCCTATCATCATTCATGCGATCACTCAAACGATGATTGGAGAGTTCTTGTGGAAG
TATACTAGGAAGGCGATTGGGAAAGGTCATGGGGAGAGGAGACATAAGAGATTCTTCTGGGTTCATCCGTATACC
AAGACTTTGTATTGGAGTTCTTCAGATCCTGGAAGCTCGAACGTGAACGAGTCGAGTGCGAAGAGCGCGTATATT
GAGGGTGTAAGATCTGTTCTGGATCCGAACCCCATGCCACCGGGCTTGTACCAATACAGCGTAGTGGTATCGACA
CCTCAACGGGAGATGAAAATTACTGCGCCGACGAAGGAAAGGCATGATATCTGGCTCAACGCACTCAAATACTTG
CTTTCTCGCCCCAGCGCAAGCGTCAATAACATGGACGATTCTCCACCTACACAGCAAAGTCCTGCGGACTACCAA
ACGGATGATGATCCCGTATCGCCCCGTAGACGACTACTATCCAGCCCTCAAAGTGTGCGAAGTCGAAGTTCGAGG
AGAGGGGGTACGCCGGGTGATACTTGGAGTTCTACACCGAAGGGTAAACGTTCACGTTCGCAATTGTCCGTCAAA
GGATCCGTGAGCAAGAGATCGGGTACACCAGCAGCGGAATATCTCAGGTGGAATGGGCCGGAAAGTCCTTATAGT
CCGTCAAGATCTTTCATAGACGAGGCTAGAGATGACGATATTGTTGGAGACGGTCACTTGGATTTGAATTTTGAG
CTGCATGATGATGATGAATTGTCGGAGGGTGGTTATGAAGGGCTGGAGAACGTGAGAGCGTGCTGTGATGGAAGG
CATACTGTTGGGCATTCGCATCCAAAGAAACATTCACATCCTCAACACCAGCAAGGACATGCGCACACAGCACCA
TTATTGACGACGCTTACGCGACACAGCTTGGAAAGTCAGCATCAACAGGCGGATTCGAATCCAATGGATATCGGA
CGACCTGCTTCGCCTGCTTGGTCTTTCAGATCGAGGACGGGGAGTGCGGATGGTCATAGTAGCGCAGCGGGAAGT
GGAAGTGGAGGATTGTTGAGTAAGCTGAGGTTCGGATCGAAGAGAGGACCTAAGAATACGCCCGTCCTACCACCT
GTCGATCAGTGA
Transcript >AgabiH97|109870
ATGGCGACCCACGACGTCCGTAGCACAGACAACATGCTCACCAGCGAGCACCCCGACGATCCTTTCCATGCCACG
ACAGCCGCGGACCTCAATTTTTATCTCCAAGGTCTCCTAGACAAGAAGGAAAAGCAGCTCCAGCAGGCTGGCAAT
CTCGGTCAACGTGTCCTGGCCCAGCAGATGGAGCTCGAAGAGCGCATTAGGCAGATCCAGGAGTCCGTCATCGAT
AAACCAGACGATGAGGAGATAGACCACGCGGCTCGCTCCAAATACCAAGAACTCAACGAGGCCATCCTCAGCTGG
GACACAGAGAACTCCCAGCTGTCGTCTGCCTTTGGTTCCAGCTCAAAGCGCTATGCGAATAGCAATCAACCATCC
CCCACTACTGCTTTTGCAGAACTCCCTAGCGAGGCTCCAGAGCACAAACGGCCTTCGGGCTCCGCAGCAGGCCAA
TCCCGGCGCGCAAAGAATGCGGCAAACCGCTCCTTCATTGATCCCGAATTTGCGATGGACATTGGCAACAACCTT
CTCGCCGAAATTCGTCGGCTTCAGAGTCTTCTCACCGAACGTGACAAGGCTATTCAGGATATGAAAGAAGAGCGA
GATGATCTCGAGAGAACCGTCGAAGCCCTCAAAACTGCGCTCAAAGAGCAAGAACGAAGTTCCGACAAATACCGC
GAAGAGAACTGGAATCTCGAAGTTACCCTTCAAGAACTCCGATCTCAACTTGCAGACTCTCAAAGCTCCGCTGTT
CGTCTAGAGACCGAGCATAAGAAACTCAGCAAATCCCTCACTCAAACCCGAGACCAAGCGGAACTTCATAAAACC
GAATCGGAAAAACATCAGGCTGCCTTCAATGACCTAAAATCGAAACACGAGAGTGACGTTGCTCAGGCCCGTAAA
CATGCAGCAGGTCTCGCCAGAGATAAACAAGATCTCCAACAAACCGTTGATACCCTCAAACTCCAAATTTCACGC
GTCAATCGTCGTTTACCCAAGTACGGTTCACCGCTCACGCCAGGTACAGGAGATAATATAAAGGATTTCATCACT
CCTGGTACGGAACGTACAGATGATACCGGAACAGACATCTTTACCGGAGGAGCCTCGACTAATCGGAGGAGATTC
GACAACTCCTTATACCCCGATGGTTTCGGTAACGAGTTCTATGACCCAGATACCCCCGAAGATTCCCCCATACGT
CGACCTTTTCAAACTCCCAATACCGAAATCGAGGCTTTGCAACAGAGGTTGGCGCATGCGCAGAGACAAATCAAT
ACCCTTAAAGGCTCACTAAATCGGGAGAAGCAAATCCGGATACGCCTTGAAAATGCTGCTGCTGGGTCTCATTCT
GCGTCTCAGCTAGGATCGGAAGGAGAAGAGGAAGAAGAAGTGGAAGAAGATGAAACGCAGGTCGAAGACGTTGCG
GAACCGAGCATCGTTTCTAGTGCGAGAGGCGGTAAACCAAGACGTGGTGGAACAGCGTTCAAGGTCGGCAGAGGA
GGATCTGGTATGGCCACGAGGCGCGGAAGGGGAAGAGGTGGAATTACTCTTATGCAGAGATTGGGTTTGGCAGCC
AATAGCCCTTCAGCGTCCTCCTATAACGACGAAGGGGAAGAATTCTCTACATCTCCCCCTACCTCTGTCCCTTCT
ATCCCCATCAATCTTCACCAAGCATCGCCGCCACGAACGGAAGAGGAGGAGGAAGAGAATTTCTTCAATTCTTCC
ACTTCGAGTCACACACTCCAACAAGATGGAATGCAATCGAACAGAACTTCGGTTGCAAGTGTTGATGGGATGGAC
CCTGCTTTCGCAAATGTGCTTAAACGTTCATCGTCATCATCATCGTACTCGAGCCCTCTTCGACATTCTCTACTT
TCGAGACGTGGCTCTACACGTAGAAAAGGTGTTACTGCGGGAAGGCGGAATCGCGGTGGTGTTCCTTTCAAAGAA
GCTAGACCTCCTTCGGTTATCAATGATAACCCTTCTGCTCTTGCTGCGGAATTGGGATTGTCACCGGGTGGTGAA
AGTGAGGCAACTGCAGAGGACGGAGCGAATACTTCTTCGCCGATGAAGGGACTGACTGGTGGTGTTACTAGTCCG
ACTAGGAGCTCTTTCTTGGACGTTGAGGAGAGTATTAGAGAGGAAGAAGAGGAACTGAGAGCTTGGAGGAAGGAA
GTCGTTGGTGAAGGAGATGAGGATGAGGATGAGGACGAAGAGGTAGAGGAGGTGGAGATGAGGGAGTTTGGATGT
CAAACTGATCCTGTTCCAGATGTTGCCAAGACTTTGGTCGATATTTCTGTTGAGACAGATTCTCAGTTCTCGCCA
TTCGCAACGATAAAAGGAAAAGCATGGCCGGAAGGATTGAGGAGGACGACGATAACTCAAAAGGACTTTGGGTCA
TTGAGGTCTTCTTCGTCCAAGACCATTTCTAATGGAGATGATCACACTATCACTCGATCTTTCCTACGTGAATCT
CATACCAACGACGATGACGCTTATTCGGAAGGAGAAGAAACCGAAACCGGTGCAGACGATACGGAAACTGAAGCC
GACTATTATGATGCTCGTACCGATATGAACACTCCTTCACTTTCAGGTCGTGCGTCAGCACTTTCGACATCTGCA
TTCACAGAATCAAGAGAAAGTTTCCATTCGATTATGACTGTTTCCGATCATGAATATCCGTCTGATTCGGGATCC
GAGTCGGATGAGAGTATTAGAGCTTCGTCTCGTCCTTCTACGGGGTTGGAACGTCGTCGACAAGAACAAGGACAA
CAATTTGGGAATGAGAGTAAGCAGAGTTTGGTTACGAGATCTGAATCGGTGGCTTCGTACTATACGACGAGTCAG
GGGCCGTTTGTTAGTTATGAAGATGTTGGTGTGGATGCGAGTGTTGAGCCTGAGGTTGTTGTGAAGGAAGTGCCG
GTGGAAGTGATTAAAGAAGTTGAAGTCGTGAAAGAGGTCAGGGTGGAAGTTCCTGTGGAGGTCATTAGGGAAGTT
GAAGTGATCAAGGAGGTTGAGGTGGTCAAAGAGGTCGTTAAAGAAGTACCGGTGGAGGTTATTAAAGAGGTGCCG
TTCGAAGTGATTAAGGAGGTCGAGGTTGTGAGGGAAGTGTTGAAAGAAGTTCCTGTGGAGGTTATTAAGGAAGTC
CGAGTTGAGGTTCCTGTTCCTGTTGAAAAGGATGTTGAGATTGTGAAGGAGGTTGTGAAAGAGGTGTTGGTGGAA
GTGCCTGTACCGAAGGAAGTGGAAGTTGTTAGGGAGGTGAGAGTGGAAGTTCCTGTGGAGGTTGTGAAGGAGGTG
ATTAGAGAGGTGGAGAAACGCGTGGAGGTGATCAAAGAAGTACCGGTCGAAGTTATTAGGGAAGTTAGAGTGGAA
GTACCTGTTGAAGTTAAGGTGCCCTTCGAAGTGGTGAAAGAGGTGGTCAAGATCGTCGAAAAACCTGTTGAAGTG
ATTCGAGAAGTCGAAGTCATCAAGGAAGTTCCAGTTGAGGTTATTCGAGACGTTGTCAGAAAAGTGCCTGTCGAA
GTCATTCGAGAAATTCCGGCGCCGAAATGTGAAGTCAGAGAGATGGAAATCCAGACGGATGATACTATGGAGTTT
GAACAATCGACGATTATGGATTTATCGAGAAAGCAGTTGTCTTCGACTTCTGTACAAGTCTCGCCGATTTCTGGA
CCAGTGTTTATTCCACCTCCTCCGACTACCGCTCCTCCTCCCTCGGCACTTTCGAGGTCGGTATCGAAATCCGGA
TCATTGGTAAATGGTTCATCGCCAACTCCATTACTTCGTACCGGAAGTCAACATCAATTCCAATTCATTCCGTCG
AACACGACGACTTCGCCTACCTCCAAATCTGACACAGCACCAATACTGCTTTCGCGCGCCAGCAGACTATCAGCT
TCTGATCGCCGCACATCTATGGAGAGTGGTATATCATCTCTGAATGCTGGCGATACTTCAACTGGGTCTGCTGGC
AATCGACCGCAAGCTGTACTGTTGAATGCTATAGACAAATCGAAACCGCCTATGATGGTACTTCCACCGCCTCCG
AAAGCGCCACCACCACCTGGTAGTATGCCTCCGCCATCATTTATTCCTGATCGTAATCGTCCACCACCGAGACCT
TTGTCCCCTCCTCCGCCAGAATTAATACAACGTGCTACAACACCCACGACATTCGGTAGGGGAGGAAGTATGAGG
CAATTGCCTAGTACAAGTAGCTTCAGATCTGCTGGGCAATATGGAACTGTTGGAAACCAACCGGTTGAAAGGAGA
CAAGTTTCAAATGCTTCTTTGGCTTATTCTGGTGGAGAGAGATCGCCGAGATCATCGATATCGTCGTCGGATGGA
CATGGGTTGCAACGCGGAGCTAGCATGATGAGTAGACCGGCGGCATCGGATGGTGGTCAAGGTGCTGGTAGTCTT
CCTGTGACTCCCAATAGAACTCCTCGTGCGGCTGGAATGACGGGAGGAGCTGTTAATGGCCATCAACAGCAACAA
CAACAGGCGTCGGGAACGGATCCTATCATCATTCATGCGATCACTCAAACGATGATTGGAGAGTTCTTGTGGAAG
TATACTAGGAAGGCGATTGGGAAAGGTCATGGGGAGAGGAGACATAAGAGATTCTTCTGGGTTCATCCGTATACC
AAGACTTTGTATTGGAGTTCTTCAGATCCTGGAAGCTCGAACGTGAACGAGTCGAGTGCGAAGAGCGCGTATATT
GAGGGTGTAAGATCTGTTCTGGATCCGAACCCCATGCCACCGGGCTTGTACCAATACAGCGTAGTGGTATCGACA
CCTCAACGGGAGATGAAAATTACTGCGCCGACGAAGGAAAGGCATGATATCTGGCTCAACGCACTCAAATACTTG
CTTTCTCGCCCCAGCGCAAGCGTCAATAACATGGACGATTCTCCACCTACACAGCAAAGTCCTGCGGACTACCAA
ACGGATGATGATCCCGTATCGCCCCGTAGACGACTACTATCCAGCCCTCAAAGTGTGCGAAGTCGAAGTTCGAGG
AGAGGGGGTACGCCGGGTGATACTTGGAGTTCTACACCGAAGGGTAAACGTTCACGTTCGCAATTGTCCGTCAAA
GGATCCGTGAGCAAGAGATCGGGTACACCAGCAGCGGAATATCTCAGGTGGAATGGGCCGGAAAGTCCTTATAGT
CCGTCAAGATCTTTCATAGACGAGGCTAGAGATGACGATATTGTTGGAGACGGTCACTTGGATTTGAATTTTGAG
CTGCATGATGATGATGAATTGTCGGAGGGTGGTTATGAAGGGCTGGAGAACGTGAGAGCGTGCTGTGATGGAAGG
CATACTGTTGGGCATTCGCATCCAAAGAAACATTCACATCCTCAACACCAGCAAGGACATGCGCACACAGCACCA
TTATTGACGACGCTTACGCGACACAGCTTGGAAAGTCAGCATCAACAGGCGGATTCGAATCCAATGGATATCGGA
CGACCTGCTTCGCCTGCTTGGTCTTTCAGATCGAGGACGGGGAGTGCGGATGGTCATAGTAGCGCAGCGGGAAGT
GGAAGTGGAGGATTGTTGAGTAAGCTGAGGTTCGGATCGAAGAGAGGACCTAAGAATACGCCCGTCCTACCACCT
GTCGATCAGTGA
Gene >AgabiH97|109870
ATGGCGACCCACGACGTCCGTAGCACAGACAACATGCTCACCAGCGAGCACCCCGACGATCCTTTCCATGCCACG
ACAGCCGCGGACCTCAATTTTTATCTCCAAGGTCTCCTAGACAAGAAGGAAAAGCAGCTCCAGCAGGCTGGCAAT
CTCGGTCAACGTGTCCTGGCCCAGCAGATGGAGCTCGAAGAGCGCATTAGGCAGATCCAGGAGTCCGTCATCGAT
AAACCAGACGATGAGGAGATAGACCACGCGGCTCGCTCCAAATACCAAGAACTCAACGAGGCCATCCTCAGCTGG
GACACAGAGAACTCCCAGCTGTCGTCTGCCTTTGGTTCCAGCTCAAAGGTCCGCCCATTTACCCGTTCAGTATTC
TCTGTCTTGCTCATACTTCTGGGATTATTTTTAGCGCTATGCGAATAGCAATCAACCATCCCCCACTACTGCTTT
TGCAGAACTCCCTAGCGAGGCTCCAGAGCACAAACGGCCTTCGGGCTCCGCAGCAGGCCAATCCCGGCGCGCAAA
GAATGCGGCAAACCGCTCCTTCATTGATCCCGGTCTGTATCCACGCCCTTTACCCTTCCCGTTACGTTCACCCCG
TAACTGACGCCCATTTATCATCAAAGAATTTGCGATGGACATTGGCAACAACCTTCTCGCCGAAATTCGTCGGCT
TCAGAGTCTTCTCACCGAACGTGACAAGGCTATTCAGGATATGAAAGAAGAGCGAGATGATCTCGAGAGAACCGT
CGAAGCCCTCAAAACTGCGCTCAAAGAGCAAGAACGAAGTTCCGGTAACGCGATCATTCTGTTTTCATTAATGAT
TCTTTTCTCACATTCATAACAATAGACAAATACCGCGAAGAGAACTGGAATCTCGAAGTTACCCTTCAAGAACTC
CGATCTCAACTTGCAGACTCTCAAAGCTCCGCTGTTCGTCTAGAGACCGAGCATAAGAAACTCAGCAAATCCCTC
ACTCAAACCCGAGACCAAGCGGAACTTCATAAAACCGAATCGGAAAAACATCAGGCTGCCTTCAATGACCTAAAA
TCGAAACACGAGAGTGACGTTGCTCAGGCCCGTAAACATGCAGCAGGTCTCGCCAGAGATAAACAAGATCTCCAA
CAAACCGTTGATACCCTCAAACTCCAAATTTCACGCGTCAATCGTCGTTTACCCAAGTACGGTTCACCGCTCACG
CCAGGTACAGGAGATAATATAAAGGATTTCATCACTCCTGGTACGGAACGTACAGATGATACCGGAACAGACATC
TTTACCGGAGGAGCCTCGACTAATCGGAGGAGATTCGACAACTCCTTATACCCCGATGGTTTCGGTAACGAGTTC
TATGACCCAGATACCCCCGAAGATTCCCCCATACGTCGACCTTTTCAAACTCCCAATACCGAAATCGAGGCTTTG
CAACAGAGGTTGGCGCATGCGCAGAGACAAATCAATACCCTTAAAGGCTCACTAAATCGGGAGAAGCAAATCCGG
ATACGCCTTGAAAATGCTGCTGCTGGGTCTCATTCTGCGTCTCAGCTAGGATCGGAAGGAGAAGAGGAAGAAGAA
GTGGAAGAAGATGAAACGCAGGTCGAAGACGTTGCGGAACCGAGCATCGTTTCTAGTGCGAGAGGCGGTAAACCA
AGACGTGGTGGAACAGCGTTCAAGGTCGGCAGAGGAGGATCTGGTATGGCCACGAGGCGCGGAAGGGGAAGAGGT
GGAATTACTCTTATGCAGAGATTGGGTTTGGCAGCCAATAGCCCTTCAGCGTCCTCCTATAACGACGAAGGGGAA
GAATTCTCTACATCTCCCCCTACCTCTGTCCCTTCTATCCCCATCAATCTTCACCAAGCATCGCCGCCACGAACG
GAAGAGGAGGAGGAAGAGAATTTCTTCAATTCTTCCACTTCGAGTCACACACTCCAACAAGATGGAATGCAATCG
AACAGAACTTCGGTTGCAAGTGTTGATGGGATGGACCCTGCTTTCGCAAATGTGCTTAAACGTTCATCGTCATCA
TCATCGTACTCGAGCCCTCTTCGACATTCTCTACTTTCGAGACGTGGCTCTACACGTAGAAAAGGTGTTACTGCG
GGAAGGCGGAATCGCGGTGGTGTTCCTTTCAAAGAAGCTAGACCTCCTTCGGTTATCAATGATAACCCTTCTGCT
CTTGCTGCGGAATTGGGATTGTCACCGGGTGGTGAAAGTGAGGCAACTGCAGAGGACGGAGCGAATACTTCTTCG
CCGATGAAGGGACTGACTGGTGGTGTTACTAGTCCGACTAGGAGCTCTTTCTTGGACGTTGAGGAGAGTATTAGA
GAGGAAGAAGAGGAACTGAGAGCTTGGAGGAAGGAAGTCGTTGGTGAAGGAGATGAGGATGAGGATGAGGACGAA
GAGGTAGAGGAGGTGGAGATGAGGGAGTTTGGATGTCAAACTGATCCTGTTCCAGATGTTGCCAAGACTTTGGTC
GATATTTCTGTTGAGACAGATTCTCAGTTCTCGCCATTCGCAACGATAAAAGGAAAAGCATGGCCGGAAGGATTG
AGGAGGACGACGATAACTCAAAAGGACTTTGGGTCATTGAGGTCTTCTTCGTCCAAGACCATTTCTAATGGAGAT
GATCACACTATCACTCGATCTTTCCTACGTGAATCTCATACCAACGACGATGACGCTTATTCGGAAGGAGAAGAA
ACCGAAACCGGTGCAGACGATACGGAAACTGAAGCCGACTATTATGATGCTCGTACCGATATGAACACTCCTTCA
CTTTCAGGTCGTGCGTCAGCACTTTCGACATCTGCATTCACAGAATCAAGAGAAAGTTTCCATTCGATTATGACT
GTTTCCGATCATGAATATCCGTCTGATTCGGGATCCGAGTCGGATGAGAGTATTAGAGCTTCGTCTCGTCCTTCT
ACGGGGTTGGAACGTCGTCGACAAGAACAAGGACAACAATTTGGGAATGAGAGTAAGCAGAGTTTGGTTACGAGA
TCTGAATCGGTGGCTTCGTACTATACGACGAGTCAGGGGCCGTTTGTTAGTTATGAAGATGTTGGTGTGGATGCG
AGTGTTGAGCCTGAGGTTGTTGTGAAGGAAGTGCCGGTGGAAGTGATTAAAGAAGTTGAAGTCGTGAAAGAGGTC
AGGGTGGAAGTTCCTGTGGAGGTCATAAGAGAAGTTGAAGTCATCAAGGAGGTGAAGGTTGAAGTTCCTGTGGAG
GTCATTAGGGAAGTTGAAGTGATCAAGGAGGTTGAGGTGGTCAAAGAGGTCGTTAAAGAAGTACCGGTGGAGGTT
ATTAAAGAGGTGCCGTTCGAAGTGATTAAGGAGGTCGAGGTTGTGAGGGAAGTGTTGAAAGAAGTTCCTGTGGAG
GTTATTAAGGAAGTCCGAGTTGAGGTTCCTGTTCCTGTTGAAAAGGATGTTGAGATTGTGAAGGAGGTTGTGAAA
GAGGTGTTGGTGGAAGTGCCTGTACCGAAGGAAGTGGAAGTTGTTAGGGAGGTGAGAGTGGAAGTTCCTGTGGAG
GTTGTGAAGGAGGTGATTAGAGAGGTGGAGAAACGCGTGGAGGTGATCAAAGAAGTACCGGTCGAAGTTATTAGG
GAAGTTAGAGTGGAAGTACCTGTTGAAGTTAAGGTGCCCTTCGAAGTGGTGAAAGAGGTGGTCAAGATCGTCGAA
AAACCTGTTGAAGTGATTCGAGAAGTCGAAGTCATCAAGGAAGTTCCAGTTGAGGTTATTCGAGACGTTGTCAGA
AAAGTGCCTGTCGAAGTCATTCGAGAAATTCCGGCGCCGAAATGTGAAGTCAGAGAGATGGAAATCCAGACGGAT
GATACTATGGAGTTTGAACAATCGACGATTATGGATTTATCGAGAAAGCAGTTGTCTTCGACTTCTGTACAAGTC
TCGCCGATTTCTGGACCAGTGTTTATTCCACCTCCTCCGACTACCGCTCCTCCTCCCTCGGCACTTTCGAGGTCG
GTATCGAAATCCGGATCATTGGTAAATGGTTCATCGCCAACTCCATTACTTCGTACCGGAAGTCAACATCAATTC
CAATTCATTCCGTCGAACACGACGACTTCGCCTACCTCCAAATCTGACACAGCACCAATACTGCTTTCGCGCGCC
AGCAGACTATCAGCTTCTGATCGCCGCACATCTATGGAGAGTGGTATATCATCTCTGAATGCTGGCGATACTTCA
ACTGGGTCTGCTGGCAATCGACCGCAAGCTGTACTGTTGAATGCTATAGACAAATCGAAACCGCCTATGATGGTA
CTTCCACCGCCTCCGAAAGCGCCACCACCACCTGGTAGTATGCCTCCGCCATCATTTATTCCTGATCGTAATCGT
CCACCACCGAGACCTTTGTCCCCTCCTCCGCCAGAATTAATACAACGTGCTACAACACCCACGACATTCGGTAGT
ACGTTAAATGTTCCTGGCGCTAATAATGGTGGTACTAACAAGAATTACCTTGGAGTAGGGGGAGGAAGTATGAGG
CAATTGCCTAGTACAAGTAGCTTCAGATCTGCTGGGCAATATGGAACTGTTGGAAACCAACCGGTTGAAAGGAGA
CAAGTTTCAAATGCTTCTTTGGCTTATTCTGGTGGAGAGAGATCGCCGAGATCATCGATATCGTCGTCGGATGGA
CATGGGTTGCAACGCGGAGCTAGCATGATGAGTAGACCGGCGGCATCGGATGGTGGTCAAGGTGCTGGTAGTCTT
CCTGTGACTCCCAATAGAACTCCTCGTGCGGCTGGAATGACGGGAGGAGCTGTTAATGGCCATCAACAGCAACAA
CAACAGGCGTCGGGAACGGATCCTATCATCATTCATGCGATCACTCAAACGATGATTGGAGAGTTCTTGTGGAAG
TATACTAGGAAGGCGATTGGGAAAGGTCATGGGGAGAGGAGACATAAGAGATTCTTCTGGGTTCATCCGTATACC
AAGACTTTGTATTGGAGTTCTTCAGATCCTGGAAGCTCGAACGTGAACGAGTCGAGTGCGAAGAGCGGTATGTGG
CTTTTGAACACCATTTTATTTGATCGATCGATTGATTGGCTATTGTAGCGTATATTGAGGGTGTAAGATCTGTTC
TGGATCCGAACCCCATGCCACCGGGCTTGTACCAATACAGCGTAGTGGTATCGACACCTCAACGGGAGATGAAAA
TTACTGCGCCGACGAAGGAAAGGCATGATATCTGGCTCAACGTATGTTATAACTTTTCAGATATTCTCTGGGAAG
ATGATCTGATTTGGAAACTACGTACAGGCACTCAAATACTTGCTTTCTCGCCCCAGCGCAAGCGTCAATAACATG
GACGATTCTCCACCTACACAGCAAAGTCCTGCGGACTACCAAACGGATGATGATCCCGTATCGCCCCGTAGACGA
CTACTATCCAGCCCTCAAAGTGTGCGAAGTCGAAGTTCGAGGAGAGGGGGTACGCCGGGTGATACTTGGAGTTCT
ACACCGAAGGGTAAACGTTCACGTTCGCAATTGTCCGTCAAAGGATCCGTGAGCAAGAGATCGGGTACACCAGCA
GCGGAATATCTCAGGTGGAATGGGCCGGAAAGTCCTTATAGTCCGTCAAGATCTTTCATAGACGAGGCTAGAGAT
GACGATATTGTTGGAGACGGTCACTTGGATTTGAATTTTGAGCTGCATGATGATGATGAATTGTCGGAGGGTGGT
TATGAAGGGCTGGAGAACGTGAGAGCGTGCTGTGATGGAAGGCATACTGTTGGGCATTCGCATCCAAAGAAACAT
TCACATCCTCAACACCAGCAAGGACATGCGCACACAGCACCATTATTGACGACGCTTACGCGACACAGCTTGGAA
AGTCAGCATCAACAGGCGGATTCGAATCCAATGGATATCGGACGACCTGCTTCGCCTGCTTGGTCTTTCAGATCG
AGGACGGGGAGTGCGGATGGTCATAGTAGCGCAGCGGGAAGTGGAAGTGGAGGATTGTTGAGTAAGCTGAGGTTC
GGATCGAAGAGAGGACCTAAGAATACGCCCGTCCTACCACCTGTCGATCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail