Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|109860
Gene name
Locationscaffold_8:915595..920688
Strand+
Gene length (bp)5093
Transcript length (bp)4350
Coding sequence length (bp)4350
Protein length (aa) 1450

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13374 TPR_10 Tetratricopeptide repeat 1.1E-07 771 809
PF13374 TPR_10 Tetratricopeptide repeat 1.7E-11 810 851
PF13374 TPR_10 Tetratricopeptide repeat 7.2E-12 852 893
PF13374 TPR_10 Tetratricopeptide repeat 5.3E-12 894 935
PF13374 TPR_10 Tetratricopeptide repeat 1.4E-11 936 977
PF13374 TPR_10 Tetratricopeptide repeat 4.1E-10 978 1019
PF13374 TPR_10 Tetratricopeptide repeat 9.7E-11 1020 1061
PF13374 TPR_10 Tetratricopeptide repeat 1.4E-11 1062 1103
PF13374 TPR_10 Tetratricopeptide repeat 2.5E-09 1104 1145
PF13374 TPR_10 Tetratricopeptide repeat 4.9E-12 1146 1187
PF13374 TPR_10 Tetratricopeptide repeat 1.4E-10 1188 1229
PF13374 TPR_10 Tetratricopeptide repeat 2.5E-09 1230 1271
PF13374 TPR_10 Tetratricopeptide repeat 1.4E-10 1272 1313
PF13374 TPR_10 Tetratricopeptide repeat 1.4E-10 1314 1355
PF13374 TPR_10 Tetratricopeptide repeat 4.8E-11 1356 1397
PF13374 TPR_10 Tetratricopeptide repeat 2.2E-08 1398 1437
PF13424 TPR_12 Tetratricopeptide repeat 2.9E-10 770 833
PF01734 Patatin Patatin-like phospholipase 5.9E-22 25 229

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 846 1181 6.0E-34
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 803 1095 1.0E-33
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 888 1178 1.0E-33
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 769 1094 2.0E-33
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 804 1097 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 846 1181 6.0E-34
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 803 1095 1.0E-33
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 888 1178 1.0E-33
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 769 1094 2.0E-33
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 804 1097 2.0E-33
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 845 1137 4.0E-33
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1013 1305 2.0E-32
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 772 1053 2.0E-32
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 808 1111 2.0E-32
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 846 1194 4.0E-32
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 808 1111 4.0E-32
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1181 1431 5.0E-32
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 850 1194 5.0E-32
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 977 1343 5.0E-32
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 772 1058 6.0E-32
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 851 1217 7.0E-32
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1014 1310 1.0E-31
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1182 1430 1.0E-31
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1014 1310 1.0E-31
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 846 1194 1.0E-31
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1014 1304 2.0E-31
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 769 1055 3.0E-31
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 1056 1352 3.0E-31
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 796 1120 3.0E-31
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 977 1343 3.0E-31
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 874 1233 3.0E-31
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 804 1097 3.0E-31
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 850 1153 4.0E-31
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 855 1246 4.0E-31
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1056 1352 5.0E-31
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 977 1343 5.0E-31
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 851 1217 6.0E-31
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 971 1263 8.0E-31
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 850 1179 8.0E-31
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 769 1101 8.0E-31
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 1186 1431 8.0E-31
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 769 1101 8.0E-31
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 846 1139 8.0E-31
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 1186 1431 9.0E-31
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 1006 1359 9.0E-31
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1140 1430 1.0E-30
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1056 1362 1.0E-30
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 796 1107 1.0E-30
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 1018 1305 2.0E-30
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1060 1362 2.0E-30
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 796 1091 2.0E-30
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 1018 1305 3.0E-30
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1056 1331 3.0E-30
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 804 1123 3.0E-30
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 772 1071 4.0E-30
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1014 1320 4.0E-30
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 772 1071 4.0E-30
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 769 1101 4.0E-30
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 981 1343 4.0E-30
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1014 1289 5.0E-30
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 1024 1427 6.0E-30
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1018 1320 7.0E-30
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 804 1111 7.0E-30
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 972 1278 8.0E-30
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 976 1263 1.0E-29
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 976 1278 1.0E-29
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 888 1179 1.0E-29
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 752 1101 1.0E-29
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1182 1446 2.0E-29
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 976 1263 2.0E-29
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1186 1379 2.0E-29
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1182 1379 2.0E-29
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 888 1179 2.0E-29
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1182 1430 3.0E-29
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 972 1278 3.0E-29
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 972 1265 3.0E-29
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 1014 1296 3.0E-29
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 855 1217 3.0E-29
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 796 1091 4.0E-29
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 1103 1427 1.0E-28
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 1107 1427 1.0E-28
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 1107 1427 1.0E-28
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 1182 1431 1.0E-28
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 846 1139 1.0E-28
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 783 1091 2.0E-28
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 1182 1418 3.0E-28
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 1140 1431 3.0E-28
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 772 1071 3.0E-28
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 1103 1427 1.0E-27
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 772 1071 2.0E-27
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 804 1097 2.0E-27
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1182 1379 2.0E-27
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 1056 1363 3.0E-27
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 930 1227 4.0E-27
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 1182 1431 6.0E-27
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1186 1401 1.0E-26
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1228 1421 2.0E-26
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1224 1421 2.0E-26
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 1182 1379 2.0E-26
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1186 1392 2.0E-26
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 1056 1363 3.0E-26
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1014 1211 3.0E-26
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1186 1392 3.0E-26
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 771 1065 4.0E-26
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1140 1404 7.0E-26
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1186 1401 7.0E-26
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1186 1401 8.0E-26
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 772 959 9.0E-26
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 850 1050 9.0E-26
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1144 1404 1.0E-25
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 771 1049 1.0E-25
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 1140 1446 1.0E-25
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 972 1265 1.0E-25
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 850 1043 1.0E-25
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 850 1043 2.0E-25
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 850 1050 2.0E-25
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 850 1050 2.0E-25
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 892 1123 3.0E-25
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1224 1438 4.0E-25
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 771 1049 4.0E-25
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1018 1249 4.0E-25
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 808 1001 4.0E-25
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1224 1421 5.0E-25
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1060 1253 5.0E-25
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 892 1085 5.0E-25
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 808 1001 5.0E-25
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1018 1224 6.0E-25
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1060 1253 6.0E-25
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 892 1085 6.0E-25
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1140 1375 7.0E-25
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 892 1092 7.0E-25
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 934 1127 8.0E-25
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 772 959 8.0E-25
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 892 1092 8.0E-25
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1140 1431 9.0E-25
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 808 1001 9.0E-25
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1060 1253 9.0E-25
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 808 1008 9.0E-25
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 934 1127 1.0E-24
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 772 959 1.0E-24
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1018 1224 1.0E-24
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1060 1260 1.0E-24
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 808 1008 1.0E-24
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1060 1260 1.0E-24
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 934 1127 2.0E-24
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 772 959 2.0E-24
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 772 966 2.0E-24
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 934 1134 2.0E-24
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1018 1233 2.0E-24
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 772 966 2.0E-24
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 934 1134 2.0E-24
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1018 1233 2.0E-24
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 771 1049 3.0E-24
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 976 1169 8.0E-24
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1102 1308 8.0E-24
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 976 1169 1.0E-23
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 976 1169 1.0E-23
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1102 1308 1.0E-23
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 976 1176 1.0E-23
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 976 1176 1.0E-23
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 771 1049 2.0E-23
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1102 1314 2.0E-23
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1144 1359 4.0E-23
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1228 1421 5.0E-23
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1102 1314 5.0E-23
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1102 1314 5.0E-23
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1144 1350 6.0E-23
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1228 1421 6.0E-23
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1228 1428 6.0E-23
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1228 1428 7.0E-23
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1144 1350 1.0E-22
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1144 1359 2.0E-22
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1144 1359 2.0E-22
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 1149 1437 2.0E-21
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 775 997 2.0E-21
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 683 969 5.0E-21
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 683 971 5.0E-20
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 683 985 9.0E-20
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 683 985 2.0E-19
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 1174 1437 2.0E-19
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 1145 1437 4.0E-19
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 1149 1437 8.0E-19
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 1145 1437 2.0E-18
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 12 346 2.0E-18
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 683 985 3.0E-18
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 12 305 1.0E-17
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 683 971 2.0E-17
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 17 346 3.0E-17
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 22 324 1.0E-15
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 683 971 6.0E-15
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1307 1437 1.0E-14
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1308 1437 1.0E-14
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1312 1437 2.0E-14
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1308 1437 2.0E-14
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 1312 1437 6.0E-14
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 1308 1437 6.0E-14
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1312 1448 8.0E-14
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1312 1437 1.0E-13
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1312 1448 1.0E-13
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 1308 1437 2.0E-13
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 1308 1437 2.0E-13
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1312 1437 2.0E-13
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1312 1437 2.0E-13
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 1308 1437 5.0E-12
sp|O23180|PLP5_ARATH Patatin-like protein 5 OS=Arabidopsis thaliana GN=PLP5 PE=1 SV=2 22 258 2.0E-11
sp|O48723|PLP2_ARATH Patatin-like protein 2 OS=Arabidopsis thaliana GN=PLP2 PE=1 SV=1 14 234 2.0E-11
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 771 939 2.0E-09
sp|Q6ZJD3|PLP2_ORYSJ Patatin-like protein 2 OS=Oryza sativa subsp. japonica GN=PLP2 PE=3 SV=1 22 234 5.0E-09
sp|A2YW91|PLP2_ORYSI Patatin-like protein 2 OS=Oryza sativa subsp. indica GN=PLP2 PE=3 SV=1 22 234 5.0E-09
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 1170 1376 3.0E-07
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 813 1312 1.0E-06
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 1002 1208 3.0E-06
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 917 1114 3.0E-06
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 1254 1403 4.0E-06
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 734 988 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6693 0.4653 0.2984 0.2068 0.1626 0.009 0.0741 0.1993 0.1232 0.0162

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup243
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016000
Agaricus bisporus var bisporus H39 AgabiH39|474700
Agaricus bisporus var bisporus H39 AgabiH39|447800
Agaricus bisporus var bisporus H39 AgabiH39|447100
Agaricus bisporus var bisporus H39 AgabiH39|373300
Agaricus bisporus var bisporus H39 AgabiH39|481100
Agaricus bisporus var bisporus H39 AgabiH39|281600
Agaricus bisporus var bisporus H39 AgabiH39|278300
Agaricus bisporus var bisporus H39 AgabiH39|053070
Agaricus bisporus var bisporus H39 AgabiH39|371700
Agaricus bisporus var bisporus H97 AgabiH97|109720
Agaricus bisporus var bisporus H97 AgabiH97|016000
Agaricus bisporus var bisporus H97 AgabiH97|016120
Agaricus bisporus var bisporus H97 AgabiH97|020470
Agaricus bisporus var bisporus H97 AgabiH97|052840
Agaricus bisporus var bisporus H97 AgabiH97|052910
Agaricus bisporus var bisporus H97 AgabiH97|053070
Agaricus bisporus var bisporus H97 AgabiH97|054350
Agaricus bisporus var bisporus H97 AgabiH97|089750
Agaricus bisporus var bisporus H97 AgabiH97|109860 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|109860
MHRMSSNTRNSGSRSTLEGPPLRLLALDGGGIRGLSELLIIKEVMHKLMFEENEKRKRDGKEPLDRLPKPCDYFD
LIGGTSTGGIIALMLGRLRMDVDTALTQYDDLAKQVFSAMKPWPWGDGKFRATTLEAAMKSVVKNVTGDSESSLL
EGDQARVCRTFVCAKNAHNMEIPVLFRTYQSRETHLNCKIWEAARATSAAPTFFKRIIIGRDQPFIDGGLGRNNP
SQVVLEEATALFGARQIGCLVSIGTGQAGIIGIKKPGLWQRILPTDVIDALKKITTDCESTHEDVLHRFSNLPST
YFRLNVEQGMQEIEFSEWEKLSNAEAHTTQYMRKEEVAKKLDLLVSAIRAPRGQLPLEQFVTPRPLNESVPQARE
LKRCPLPVQPFKGREEILDKMRNYFELGSDSRRVFVLHGLGGSGKTQIALKFVQESTCFSDVFYIDATNEQTLRT
DLEAITLGNKERSIDASLRWLASQRQGSWLLFFDNADDVNLKLKKFLPQSGNILVTTRNPELRILSAKDGDAKVG
AMEHEDAKNLLLDRARAEESYENKVLAEAIVQDLHYFALAISQAGAYIRCHLSLSEYREFYQRHHHKLLQNEDFQ
GEDPYERAVYATWSLSYDRLDASARSLLQIFSLLNHEGISDKMFEKAASSEEQLEDAELQNKVTELLNELGKRGP
DWSWDFKEVAKRLRSYSLIEYDTQNHTYSIHPLVQQWSRSTMEENRQLMRKCVLSIIGLSISWTFKDQDYKYRRT
LLQHISSSRASVEPEQMAPSALRGLALVYSEQGLWKEAEALEVVVMEKRKRLLGDDHPDTLTSMSNLASTYGEQG
KWNEAEALQVVVMEKMKRLLGDDHPDTLTSMSNLASTYGKQGKWNEAEALEVVVMEKRKRLLGDDHPDTLMSMGN
LASTYGDQGKWNEAEALEAVVMEKRKRLLGDDHPDTLTSMSNLAGTYGKQGKWNEAEALEVVVMEKRKRLLGDDH
PDTLTSMSHLASTYGDQGKWNEAKALEVVVMEKRKRLLGDDHPDTLMSMGNLASTYGEQGKWKEAEALEAVVMEK
MKRLLGDDHPDTLTSMSNLAGTYGKQGKWNEAEALEVVVMEKRKRLLGDDHPDTLTSMSHLASTYGDQGKWNKAK
ALEVVVMEKRKRLLGDDHPDTLTSMSNLASTYGEQGKWNEAEALEVVVMEKRKRLLGDDHPDTLMSMGNLASTYG
EQGKWNEAEALEVVVMEKMKRLLGDDHPDTLTSMSHLASTYGDQGKWNKAKALEVVVMEKRKRLLGDDHPDTLMS
MGNLASTYGEQGKWNEAEALEVVVMEKMKRLLGDDHPDTLMSMGNLASTYGEQGKWNEAEALEVVVMEKMKRLLG
DDHPDTLTSMSNLASTYGEQGKWNEAEALEVVVMEKMKRLLGDDHPDTLTSMSNLASTYGEQGKWNEAEALEVVV
MEKRKRLRGDDHDCSILRCFNTGS*
Coding >AgabiH97|109860
ATGCATAGGATGTCATCTAATACAAGGAACTCGGGATCCCGATCAACTTTAGAAGGACCACCTTTGAGGCTGCTT
GCGCTAGATGGCGGCGGGATACGCGGACTTTCAGAACTACTCATCATCAAAGAAGTCATGCACAAGCTGATGTTT
GAGGAGAACGAAAAACGGAAAAGGGATGGCAAAGAACCTCTTGACAGACTCCCGAAGCCGTGCGATTACTTCGAT
CTGATTGGTGGTACTAGTACTGGAGGGATAATTGCTTTGATGCTTGGGCGTCTCCGGATGGATGTAGACACGGCA
TTAACACAATACGATGATCTGGCAAAACAAGTCTTCTCCGCTATGAAGCCATGGCCGTGGGGAGACGGAAAATTC
AGGGCGACAACACTCGAAGCAGCCATGAAATCTGTCGTGAAGAACGTAACTGGTGATTCAGAGTCATCCTTATTA
GAAGGTGATCAAGCTAGAGTCTGCCGAACTTTCGTCTGTGCCAAGAACGCCCACAACATGGAAATTCCAGTGCTT
TTCAGGACATACCAGTCTCGTGAAACACATTTAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCGGCA
CCCACCTTTTTCAAGCGCATTATAATTGGGCGGGACCAGCCCTTTATCGATGGCGGACTGGGCCGCAATAATCCG
AGTCAGGTGGTCCTGGAAGAAGCCACTGCTCTATTTGGCGCTCGTCAAATCGGGTGCTTGGTGAGCATTGGCACT
GGACAGGCCGGAATAATCGGGATCAAGAAACCTGGGTTATGGCAGCGAATCCTACCAACCGACGTCATCGATGCG
TTAAAAAAAATAACCACCGACTGCGAATCAACACACGAAGATGTGTTGCACCGTTTCTCCAACCTGCCGAGCACC
TATTTTCGGTTAAATGTCGAGCAGGGGATGCAGGAAATAGAGTTTTCCGAATGGGAGAAACTGAGCAATGCAGAG
GCTCATACAACGCAATATATGAGGAAGGAGGAGGTCGCCAAGAAGCTTGACTTGTTGGTTAGTGCGATCAGAGCC
CCGAGAGGGCAGCTTCCACTCGAGCAATTCGTTACTCCTAGGCCTCTCAATGAATCGGTTCCACAAGCCAGGGAA
CTCAAGCGTTGTCCCCTTCCTGTGCAACCATTTAAGGGACGAGAAGAAATCCTTGATAAGATGCGCAATTATTTT
GAGTTAGGGAGTGATTCTCGACGCGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTCTC
AAATTTGTGCAAGAATCAACCTGCTTCTCCGACGTCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACA
GACCTTGAGGCCATCACTCTAGGGAATAAAGAGCGATCAATAGATGCAAGTCTTCGTTGGCTTGCAAGCCAGCGC
CAGGGAAGCTGGCTTCTCTTCTTCGACAATGCGGACGATGTGAACTTGAAACTGAAGAAATTCCTTCCTCAATCT
GGAAACATCCTGGTTACAACACGTAATCCAGAGCTTCGCATTCTCTCCGCGAAAGACGGGGATGCAAAAGTTGGT
GCGATGGAGCACGAAGATGCGAAAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGCTATGAAAATAAAGTG
TTGGCAGAGGCAATTGTACAGGATCTTCACTACTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTATATTCGTTGC
CACTTGTCGTTAAGCGAATATCGAGAATTCTATCAACGTCACCACCACAAACTGTTACAGAACGAAGATTTTCAA
GGAGAAGATCCATACGAACGAGCGGTGTATGCGACGTGGAGTTTGAGCTACGACAGACTTGACGCGTCAGCAAGA
TCTTTGCTCCAAATCTTCTCGTTGCTAAATCACGAAGGAATCTCGGACAAAATGTTCGAAAAGGCGGCATCGTCT
GAAGAGCAACTGGAGGATGCCGAACTACAAAACAAAGTGACTGAGTTGTTGAACGAGCTGGGAAAACGAGGTCCA
GACTGGTCTTGGGACTTTAAGGAGGTCGCCAAGCGCCTTCGTTCATATTCGCTCATTGAATATGATACTCAAAAT
CACACCTACAGCATTCATCCGCTGGTACAACAGTGGAGTCGTAGCACCATGGAAGAAAACAGACAGCTCATGCGG
AAATGTGTACTCAGCATCATTGGCCTATCGATTTCTTGGACATTCAAGGACCAGGACTACAAATACAGACGCACA
CTTTTGCAACATATCTCCAGCTCCAGAGCCTCAGTTGAACCAGAACAGATGGCGCCTTCGGCTTTGAGAGGTTTG
GCACTTGTGTACTCCGAACAGGGGTTGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAG
CGGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGAGCAATCTTGCGTCTACGTACGGGGAACAGGGG
AAGTGGAACGAAGCTGAGGCGCTTCAGGTGGTGGTGATGGAGAAGATGAAGCGGCTGCTTGGTGATGATCATCCT
GACACACTCACGAGCATGAGCAATCTTGCGTCTACGTACGGGAAACAGGGGAAGTGGAATGAAGCTGAGGCGCTT
GAGGTGGTGGTAATGGAGAAGAGGAAGCGACTGCTTGGTGATGATCATCCTGACACACTCATGAGCATGGGCAAT
CTTGCGTCTACGTACGGGGACCAGGGGAAGTGGAACGAAGCAGAGGCGCTTGAGGCAGTGGTGATGGAGAAGAGG
AAGCGACTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGAGCAACCTTGCAGGCACATACGGGAAACAG
GGGAAGTGGAATGAAGCTGAGGCGCTTGAGGTGGTGGTAATGGAGAAGAGGAAGCGGCTGCTTGGTGATGATCAT
CCTGACACACTCACGAGCATGAGCCATCTTGCGTCTACGTACGGGGACCAGGGGAAGTGGAACGAAGCAAAGGCG
CTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCATGAGCATGGGC
AATCTTGCGTCTACGTACGGGGAACAGGGGAAGTGGAAAGAAGCAGAGGCGCTTGAGGCAGTGGTGATGGAGAAG
ATGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGAGCAACCTTGCAGGCACATACGGGAAA
CAGGGGAAGTGGAATGAAGCTGAGGCGCTTGAGGTGGTGGTAATGGAGAAGAGGAAGCGGCTGCTTGGTGATGAT
CATCCTGACACACTCACGAGCATGAGCCATCTTGCGTCTACGTACGGGGACCAGGGGAAGTGGAACAAAGCAAAG
GCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATG
AGCAATCTTGCGTCTACGTACGGGGAACAGGGGAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAG
AAGAGGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCATGAGCATGGGCAATCTTGCGTCTACGTACGGG
GAACAGGGAAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGATGAAGCGGCTGCTTGGTGAT
GATCATCCTGACACACTCACGAGCATGAGCCATCTTGCGTCTACGTATGGGGACCAGGGGAAGTGGAACAAAGCA
AAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCATGAGC
ATGGGCAATCTTGCGTCTACGTACGGGGAACAGGGAAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTGGTGATG
GAGAAGATGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCATGAGCATGGGCAATCTTGCGTCTACGTAC
GGGGAACAGGGAAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGATGAAGCGGCTGCTTGGT
GATGATCATCCTGACACACTCACGAGCATGAGCAATCTTGCGTCTACGTATGGGGAACAGGGGAAGTGGAACGAA
GCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGATGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCACG
AGCATGAGCAATCTTGCGTCTACGTATGGGGAACAGGGGAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTGGTG
ATGGAGAAGAGGAAGCGGCTGCGTGGCGATGATCATGATTGTTCAATACTGAGGTGCTTCAACACGGGGAGTTAA
Transcript >AgabiH97|109860
ATGCATAGGATGTCATCTAATACAAGGAACTCGGGATCCCGATCAACTTTAGAAGGACCACCTTTGAGGCTGCTT
GCGCTAGATGGCGGCGGGATACGCGGACTTTCAGAACTACTCATCATCAAAGAAGTCATGCACAAGCTGATGTTT
GAGGAGAACGAAAAACGGAAAAGGGATGGCAAAGAACCTCTTGACAGACTCCCGAAGCCGTGCGATTACTTCGAT
CTGATTGGTGGTACTAGTACTGGAGGGATAATTGCTTTGATGCTTGGGCGTCTCCGGATGGATGTAGACACGGCA
TTAACACAATACGATGATCTGGCAAAACAAGTCTTCTCCGCTATGAAGCCATGGCCGTGGGGAGACGGAAAATTC
AGGGCGACAACACTCGAAGCAGCCATGAAATCTGTCGTGAAGAACGTAACTGGTGATTCAGAGTCATCCTTATTA
GAAGGTGATCAAGCTAGAGTCTGCCGAACTTTCGTCTGTGCCAAGAACGCCCACAACATGGAAATTCCAGTGCTT
TTCAGGACATACCAGTCTCGTGAAACACATTTAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCGGCA
CCCACCTTTTTCAAGCGCATTATAATTGGGCGGGACCAGCCCTTTATCGATGGCGGACTGGGCCGCAATAATCCG
AGTCAGGTGGTCCTGGAAGAAGCCACTGCTCTATTTGGCGCTCGTCAAATCGGGTGCTTGGTGAGCATTGGCACT
GGACAGGCCGGAATAATCGGGATCAAGAAACCTGGGTTATGGCAGCGAATCCTACCAACCGACGTCATCGATGCG
TTAAAAAAAATAACCACCGACTGCGAATCAACACACGAAGATGTGTTGCACCGTTTCTCCAACCTGCCGAGCACC
TATTTTCGGTTAAATGTCGAGCAGGGGATGCAGGAAATAGAGTTTTCCGAATGGGAGAAACTGAGCAATGCAGAG
GCTCATACAACGCAATATATGAGGAAGGAGGAGGTCGCCAAGAAGCTTGACTTGTTGGTTAGTGCGATCAGAGCC
CCGAGAGGGCAGCTTCCACTCGAGCAATTCGTTACTCCTAGGCCTCTCAATGAATCGGTTCCACAAGCCAGGGAA
CTCAAGCGTTGTCCCCTTCCTGTGCAACCATTTAAGGGACGAGAAGAAATCCTTGATAAGATGCGCAATTATTTT
GAGTTAGGGAGTGATTCTCGACGCGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTCTC
AAATTTGTGCAAGAATCAACCTGCTTCTCCGACGTCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACA
GACCTTGAGGCCATCACTCTAGGGAATAAAGAGCGATCAATAGATGCAAGTCTTCGTTGGCTTGCAAGCCAGCGC
CAGGGAAGCTGGCTTCTCTTCTTCGACAATGCGGACGATGTGAACTTGAAACTGAAGAAATTCCTTCCTCAATCT
GGAAACATCCTGGTTACAACACGTAATCCAGAGCTTCGCATTCTCTCCGCGAAAGACGGGGATGCAAAAGTTGGT
GCGATGGAGCACGAAGATGCGAAAAACCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGCTATGAAAATAAAGTG
TTGGCAGAGGCAATTGTACAGGATCTTCACTACTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTATATTCGTTGC
CACTTGTCGTTAAGCGAATATCGAGAATTCTATCAACGTCACCACCACAAACTGTTACAGAACGAAGATTTTCAA
GGAGAAGATCCATACGAACGAGCGGTGTATGCGACGTGGAGTTTGAGCTACGACAGACTTGACGCGTCAGCAAGA
TCTTTGCTCCAAATCTTCTCGTTGCTAAATCACGAAGGAATCTCGGACAAAATGTTCGAAAAGGCGGCATCGTCT
GAAGAGCAACTGGAGGATGCCGAACTACAAAACAAAGTGACTGAGTTGTTGAACGAGCTGGGAAAACGAGGTCCA
GACTGGTCTTGGGACTTTAAGGAGGTCGCCAAGCGCCTTCGTTCATATTCGCTCATTGAATATGATACTCAAAAT
CACACCTACAGCATTCATCCGCTGGTACAACAGTGGAGTCGTAGCACCATGGAAGAAAACAGACAGCTCATGCGG
AAATGTGTACTCAGCATCATTGGCCTATCGATTTCTTGGACATTCAAGGACCAGGACTACAAATACAGACGCACA
CTTTTGCAACATATCTCCAGCTCCAGAGCCTCAGTTGAACCAGAACAGATGGCGCCTTCGGCTTTGAGAGGTTTG
GCACTTGTGTACTCCGAACAGGGGTTGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAG
CGGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGAGCAATCTTGCGTCTACGTACGGGGAACAGGGG
AAGTGGAACGAAGCTGAGGCGCTTCAGGTGGTGGTGATGGAGAAGATGAAGCGGCTGCTTGGTGATGATCATCCT
GACACACTCACGAGCATGAGCAATCTTGCGTCTACGTACGGGAAACAGGGGAAGTGGAATGAAGCTGAGGCGCTT
GAGGTGGTGGTAATGGAGAAGAGGAAGCGACTGCTTGGTGATGATCATCCTGACACACTCATGAGCATGGGCAAT
CTTGCGTCTACGTACGGGGACCAGGGGAAGTGGAACGAAGCAGAGGCGCTTGAGGCAGTGGTGATGGAGAAGAGG
AAGCGACTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGAGCAACCTTGCAGGCACATACGGGAAACAG
GGGAAGTGGAATGAAGCTGAGGCGCTTGAGGTGGTGGTAATGGAGAAGAGGAAGCGGCTGCTTGGTGATGATCAT
CCTGACACACTCACGAGCATGAGCCATCTTGCGTCTACGTACGGGGACCAGGGGAAGTGGAACGAAGCAAAGGCG
CTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCATGAGCATGGGC
AATCTTGCGTCTACGTACGGGGAACAGGGGAAGTGGAAAGAAGCAGAGGCGCTTGAGGCAGTGGTGATGGAGAAG
ATGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGAGCAACCTTGCAGGCACATACGGGAAA
CAGGGGAAGTGGAATGAAGCTGAGGCGCTTGAGGTGGTGGTAATGGAGAAGAGGAAGCGGCTGCTTGGTGATGAT
CATCCTGACACACTCACGAGCATGAGCCATCTTGCGTCTACGTACGGGGACCAGGGGAAGTGGAACAAAGCAAAG
GCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATG
AGCAATCTTGCGTCTACGTACGGGGAACAGGGGAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAG
AAGAGGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCATGAGCATGGGCAATCTTGCGTCTACGTACGGG
GAACAGGGAAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGATGAAGCGGCTGCTTGGTGAT
GATCATCCTGACACACTCACGAGCATGAGCCATCTTGCGTCTACGTATGGGGACCAGGGGAAGTGGAACAAAGCA
AAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCATGAGC
ATGGGCAATCTTGCGTCTACGTACGGGGAACAGGGAAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTGGTGATG
GAGAAGATGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCATGAGCATGGGCAATCTTGCGTCTACGTAC
GGGGAACAGGGAAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGATGAAGCGGCTGCTTGGT
GATGATCATCCTGACACACTCACGAGCATGAGCAATCTTGCGTCTACGTATGGGGAACAGGGGAAGTGGAACGAA
GCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGATGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCACG
AGCATGAGCAATCTTGCGTCTACGTATGGGGAACAGGGGAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTGGTG
ATGGAGAAGAGGAAGCGGCTGCGTGGCGATGATCATGATTGTTCAATACTGAGGTGCTTCAACACGGGGAGTTAA
Gene >AgabiH97|109860
ATGCATAGGATGTCATCTAATACAAGGAACTCGGGATCCCGATCAACGTTCGGGGCCCCCTTTCGCTTCTCAATA
ACCAGTTATCGCAGCAAACAGTACTAGGCCTTGCCGTGAGAAAGTTTAGGTGCGTGCATGCAGCATGTCATATCT
CATAGCCTCTCCTTGGTCTTAACAATGACTTCTTCTGCAGAAGGACCACCTTTGAGGCTGCTTGCGCTAGGTATA
TGCGTCCGTTTGCACTCTCTCACCGATAGAGTCGCTAACTAGAAAACTCTGAACAGATGGCGGCGGGATACGCGG
ACTTTCAGAACTACTCATCATCAAAGAAGTCATGCACAAGCTGATGTTTGAGGAGAACGAAAAACGGAAAAGGGA
TGGCAAAGAACCTCTTGACAGACTCCCGAAGCCGTGCGATTACTTCGATCTGATTGGTGGTACTAGTACTGGAGG
GTGCGCTGCGTTATACACCTACAATCGTCTCATGTTACTCACATGTATATTACAGGATAATTGCTTTGATGCTTG
GGCGTCTCCGGATGGATGTAGACACGGCATTAACACAATACGATGATCTGGCAAAACAAGTCTTCTCCGCTATGA
AGCCATGGCCGTGGGGAGACGGAAAATTCAGGGCGACAACACTCGAAGCAGCCATGAAATCTGTCGTGAAGAACG
TAACTGGTGATTCAGAGTCATCCTTATTAGAAGGTGATCAAGCTAGAGTCTGCCGAACGTGAGTATATTGCTTAC
TCTTCCATGCATTCCGACTTTGAATTAAAAGATTTACTAGTTTCGTCTGTGCCAAGAACGCCCACAACATGGAAA
TTCCAGTGCTTTTCAGGACATACCAGTCTCGTGAAACACATTTAAATTGCAAGATTTGGGAGGCCGCTCGAGCGA
CATCTGCGGCACCCACCTTTTTCAAGCGCATTATAATTGGGCGGGACCAGCCCTTTATCGATGGCGGACTGGGCC
GCAATAATCCGAGTCAGGTGGTCCTGGAAGAAGCCACTGCTCTATTTGGCGCTCGTCAAATCGGGTGCTTGGTGA
GCATTGGCACTGGACAGGCCGGAATAATCGGGATCAAGAAACCTGGGTTATGGCAGCGAATCCTACCAACCGACG
TCATCGATGCGTTAAAAAAAATAACCACCGACTGCGAATCAACACACGAAGATGTGTTGCACCGTTTCTCCAACC
TGCCGAGCACCTATTTTCGGTTAAATGTCGAGCAGGGGATGCAGGAAATAGAGTTTTCCGAATGGGAGAAACTGA
GCAATGCAGAGGCTCATACAACGCAATATATGAGGAAGGAGGAGGTCGCCAAGAAGCTTGACTTGTTGGTTAGTG
CGATCAGAGCCCCGAGAGGGCAGCTTCCACTCGAGCAATTCGGTACGGAATAATCACTCTTGTAGATCTTCATAG
TAACCTAATCTCGTTACCCTAGTTACTCCTAGGCCTCTCAATGAATCGGTTCCACAAGCCAGGGAACTCAAGCGT
TGTCCCCTTCCTGTGCAACCATTTAAGGGACGAGAAGAAATCCTTGATAAGATGCGCAATTATTTTGAGTTAGGG
AGTGATTCTCGACGCGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTCTCAAATTTGTG
CAAGAATCAACCTGGTATGATCCTACTCTCTACAAATTCGCGACTGGCGACAATTTACATGTTTAATTTCCAGCT
TCTCCGACGTCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACAGACCTTGAGGCCATCACTCTAGGGA
ATAAAGAGCGATCAATAGATGCAAGTCTTCGTTGGCTTGCAAGCCAGCGCCAGGGAAGCTGGCTTCTCTTCTTCG
ACAATGCGGACGATGTGAACTTGAAACTGAAGAAATTCCTTCCTCAATCTGGAAACATCCTGGTTACAACACGTA
ATCCAGAGCTTCGCATTCTCTCCGCGAAAGACGGGGATGCAAAAGTTGGTGCGATGGAGCACGAAGATGCGAAAA
ACCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGCTATGAAAATAAAGTGTTGGCAGAGGCAATTGTACAGGTTA
TTCATCTCATTTTCGTTTCTTCAGAAAACATTTTCAGTCTAAAGCACGAGACAGGATCTTCACTACTTTGCTTTG
GCTATTTCCCAAGCTGGCGCTTATATTCGTTGCCACTTGTCGTTAAGCGAATATCGAGAATTCTATCAACGTCAC
CACCACAAACTGTTACAGAACGAAGATTTTCAAGGAGAAGATCCATACGAACGAGCGGTGTATGCGACGTGGAGT
TTGAGCTACGACAGACTTGACGCGTCAGCAAGATCTTTGCTCCAAATCTTCTCGTTGCTAAATCACGAAGGAATC
TCGGACAAAATGTTCGAAAAGGCGGCATCGTCTGAAGAGCAACTGGAGGATGCCGAACTACAAAACAAAGTGACT
GAGTTGTTGAACGAGCTGGGAAAACGAGGTCCAGACTGGTCTTGGGACTTTAAGGAGGTCGCCAAGCGCCTTCGT
TCATATTCGCTCATTGAATATGATACTCAAAATCACACCTACAGCATTCATCCGCTGGTACAACAGTGGAGTCGT
AGCACCATGGAAGAAAACAGACAGCTCATGCGGAAATGTGTACTCAGCATCATTGGCCTATCGATTTCTTGGACA
TTCAAGGACCAGGACTACAAATACAGACGCACACTTTTGCAACATATCTCCAGCTCCAGAGCCTCAGTTGAACCA
GAACAGATGGCGCCTTCGGCTTTGAGAGGTTTGGCACTTGTGTACTCCGAACAGGGGTTGTGGAAGGAAGCAGAG
GCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATG
AGCAATCTTGCGTCTACGTACGGGGAACAGGGGAAGTGGAACGAAGCTGAGGCGCTTCAGGTGGTGGTGATGGAG
AAGATGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGAGCAATCTTGCGTCTACGTACGGG
AAACAGGGGAAGTGGAATGAAGCTGAGGCGCTTGAGGTGGTGGTAATGGAGAAGAGGAAGCGACTGCTTGGTGAT
GATCATCCTGACACACTCATGAGCATGGGCAATCTTGCGTCTACGTACGGGGACCAGGGGAAGTGGAACGAAGCA
GAGGCGCTTGAGGCAGTGGTGATGGAGAAGAGGAAGCGACTGCTTGGTGATGATCATCCTGACACACTCACGAGC
ATGAGCAACCTTGCAGGCACATACGGGAAACAGGGGAAGTGGAATGAAGCTGAGGCGCTTGAGGTGGTGGTAATG
GAGAAGAGGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGAGCCATCTTGCGTCTACGTAC
GGGGACCAGGGGAAGTGGAACGAAGCAAAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTTGGT
GATGATCATCCTGACACACTCATGAGCATGGGCAATCTTGCGTCTACGTACGGGGAACAGGGGAAGTGGAAAGAA
GCAGAGGCGCTTGAGGCAGTGGTGATGGAGAAGATGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCACG
AGCATGAGCAACCTTGCAGGCACATACGGGAAACAGGGGAAGTGGAATGAAGCTGAGGCGCTTGAGGTGGTGGTA
ATGGAGAAGAGGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGAGCCATCTTGCGTCTACG
TACGGGGACCAGGGGAAGTGGAACAAAGCAAAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTT
GGTGATGATCATCCTGACACACTCACGAGCATGAGCAATCTTGCGTCTACGTACGGGGAACAGGGGAAGTGGAAC
GAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTC
ATGAGCATGGGCAATCTTGCGTCTACGTACGGGGAACAGGGAAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTG
GTGATGGAGAAGATGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGAGCCATCTTGCGTCT
ACGTATGGGGACCAGGGGAAGTGGAACAAAGCAAAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTG
CTTGGTGATGATCATCCTGACACACTCATGAGCATGGGCAATCTTGCGTCTACGTACGGGGAACAGGGAAAGTGG
AACGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGATGAAGCGGCTGCTTGGTGATGATCATCCTGACACA
CTCATGAGCATGGGCAATCTTGCGTCTACGTACGGGGAACAGGGAAAGTGGAACGAAGCAGAGGCGCTTGAGGTG
GTGGTGATGGAGAAGATGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGAGCAATCTTGCG
TCTACGTATGGGGAACAGGGGAAGTGGAACGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGATGAAGCGG
CTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGAGCAATCTTGCGTCTACGTATGGGGAACAGGGGAAG
TGGAACGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGCGGCTGCTTGGTGATGATCATCCTGAC
ACACTCACGAGCATGGCCAATCTGGCATCTATGTACAGGGACCAGGGGAACAGGGGAAGTGGAAAGAAGCAGAGG
CGCTTTAGGTGGTGGCGATGGAGAAGATGAAGCGGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGG
AAAATCTTGCGTCTACGTACGGGGACCAGGGGAAGTGGAACGAAGCAGAGGCGCTTCAGGTGGTGGTGATGGAGA
AGAGGAAGCGGCTGCGTGGCGATGATCATGATTGTTCAATACTGAGGTGCTTCAACACGGGGAGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail