Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|109580
Gene name
Locationscaffold_8:844299..845508
Strand+
Gene length (bp)1209
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 5.1E-19 24 146
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 5.6E-19 26 395
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.4E-08 25 183

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 24 402 4.0E-16
sp|O31581|YFHM_BACSU AB hydrolase superfamily protein YfhM OS=Bacillus subtilis (strain 168) GN=yfhM PE=3 SV=1 24 145 5.0E-16
sp|Q6IE26|EPHX4_MOUSE Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 SV=2 16 145 3.0E-12
sp|Q0IIS3|EPHX3_XENTR Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3 PE=2 SV=1 21 145 3.0E-11
sp|Q8IUS5|EPHX4_HUMAN Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2 16 145 8.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 24 402 4.0E-16
sp|O31581|YFHM_BACSU AB hydrolase superfamily protein YfhM OS=Bacillus subtilis (strain 168) GN=yfhM PE=3 SV=1 24 145 5.0E-16
sp|Q6IE26|EPHX4_MOUSE Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 SV=2 16 145 3.0E-12
sp|Q0IIS3|EPHX3_XENTR Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3 PE=2 SV=1 21 145 3.0E-11
sp|Q8IUS5|EPHX4_HUMAN Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2 16 145 8.0E-11
sp|G5EBI4|CEEH1_CAEEL Epoxide hydrolase 1 OS=Caenorhabditis elegans GN=ceeh-1 PE=1 SV=1 24 153 5.0E-10
sp|P80299|HYES_RAT Bifunctional epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1 24 402 7.0E-10
sp|P34913|HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2 24 146 2.0E-09
sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2 24 152 1.0E-07
sp|Q9H6B9|EPHX3_HUMAN Epoxide hydrolase 3 OS=Homo sapiens GN=EPHX3 PE=2 SV=1 24 144 2.0E-06
sp|Q3V1F8|EPHX3_MOUSE Epoxide hydrolase 3 OS=Mus musculus GN=Ephx3 PE=2 SV=2 24 145 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 41.85 24.29 59.40
Initials Initials knots 35.84 20.54 51.13
Pileal_Stipeal_center Stage I stipe center 36.30 20.72 51.88
Pileal_Stipeal_shell Stage I stipe shell 40.13 23.06 57.20
DIF_stipe_center Stage II stipe center 34.36 19.58 49.15
DIF_stipe_shell Stage II stipe shell 34.00 19.36 48.65
DIF_stipe_skin Stage II stipe skin 36.10 20.57 51.64
DIF_cap_skin Stage II cap skin 47.22 27.59 66.85
DIF_cap_tissue Stage II cap tissue 44.62 26.01 63.24
DIF_gill_tissue Stage II gill tissue 45.51 26.57 64.45
YFB_stipe_center Young fruiting body stipe center 34.66 19.88 49.44
YFB_stipe_shell Young fruiting body stipe shell 34.03 19.45 48.61
YFB_stipe_skin Young fruiting body stipe skin 37.56 21.59 53.53
YFB_cap_skin Young fruiting body cap skin 36.91 21.26 52.55
YFB_cap_tissue Young fruiting body cap tissue 45.74 26.76 64.73
YFB_gill_tissue Young fruiting body gill tissue 39.14 22.44 55.85
YFB_veil Young fruiting body veil 42.23 24.61 59.85

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.866879 no
Casing YFB_stipe_center 0.640267 no
Casing YFB_stipe_shell 0.596755 no
Casing YFB_stipe_skin 0.821168 no
Casing YFB_cap_skin 0.783777 no
Casing YFB_cap_tissue 0.861229 no
Casing YFB_gill_tissue 0.900545 no
Casing YFB_veil 0.987027 no
Casing Initials 0.718530 no
Casing Pileal_Stipeal_center 0.750261 no
Casing Pileal_Stipeal_shell 0.940589 no
Casing DIF_stipe_center 0.619611 no
Casing DIF_stipe_shell 0.593139 no
Casing DIF_stipe_skin 0.735604 no
Casing DIF_cap_skin 0.792399 no
Casing DIF_cap_tissue 0.900960 no
DIF_gill_tissue YFB_stipe_center 0.444283 no
DIF_gill_tissue YFB_stipe_shell 0.397993 no
DIF_gill_tissue YFB_stipe_skin 0.634518 no
DIF_gill_tissue YFB_cap_skin 0.590660 no
DIF_gill_tissue YFB_cap_tissue 0.992172 no
DIF_gill_tissue YFB_gill_tissue 0.731280 no
DIF_gill_tissue YFB_veil 0.886146 no
YFB_stipe_center YFB_stipe_shell 0.974793 no
YFB_stipe_center YFB_stipe_skin 0.877441 no
YFB_stipe_center YFB_cap_skin 0.908862 no
YFB_stipe_center YFB_cap_tissue 0.422001 no
YFB_stipe_center YFB_gill_tissue 0.794616 no
YFB_stipe_center YFB_veil 0.613099 no
YFB_stipe_shell YFB_stipe_skin 0.843211 no
YFB_stipe_shell YFB_cap_skin 0.877146 no
YFB_stipe_shell YFB_cap_tissue 0.388722 no
YFB_stipe_shell YFB_gill_tissue 0.755587 no
YFB_stipe_shell YFB_veil 0.566429 no
YFB_stipe_skin YFB_cap_skin 0.975558 no
YFB_stipe_skin YFB_cap_tissue 0.620193 no
YFB_stipe_skin YFB_gill_tissue 0.941778 no
YFB_stipe_skin YFB_veil 0.801872 no
YFB_cap_skin YFB_cap_tissue 0.579902 no
YFB_cap_skin YFB_gill_tissue 0.913319 no
YFB_cap_skin YFB_veil 0.760791 no
YFB_cap_tissue YFB_gill_tissue 0.718104 no
YFB_cap_tissue YFB_veil 0.878007 no
YFB_gill_tissue YFB_veil 0.885161 no
Initials DIF_gill_tissue 0.519091 no
Initials YFB_stipe_center 0.955268 no
Initials YFB_stipe_shell 0.927453 no
Initials YFB_stipe_skin 0.934403 no
Initials YFB_cap_skin 0.959864 no
Initials YFB_cap_tissue 0.511942 no
Initials YFB_gill_tissue 0.864395 no
Initials YFB_veil 0.698136 no
Initials Pileal_Stipeal_center 0.982343 no
Initials Pileal_Stipeal_shell 0.816391 no
Initials DIF_stipe_center 0.941269 no
Initials DIF_stipe_shell 0.926006 no
Initials DIF_stipe_skin 0.989031 no
Initials DIF_cap_skin 0.431397 no
Initials DIF_cap_tissue 0.567448 no
Pileal_Stipeal_center DIF_gill_tissue 0.547695 no
Pileal_Stipeal_center YFB_stipe_center 0.936093 no
Pileal_Stipeal_center YFB_stipe_shell 0.905639 no
Pileal_Stipeal_center YFB_stipe_skin 0.952723 no
Pileal_Stipeal_center YFB_cap_skin 0.977825 no
Pileal_Stipeal_center YFB_cap_tissue 0.539647 no
Pileal_Stipeal_center YFB_gill_tissue 0.886479 no
Pileal_Stipeal_center YFB_veil 0.729633 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.842101 no
Pileal_Stipeal_center DIF_stipe_center 0.920318 no
Pileal_Stipeal_center DIF_stipe_shell 0.903694 no
Pileal_Stipeal_center DIF_stipe_skin 0.991786 no
Pileal_Stipeal_center DIF_cap_skin 0.461539 no
Pileal_Stipeal_center DIF_cap_tissue 0.596348 no
Pileal_Stipeal_shell DIF_gill_tissue 0.785227 no
Pileal_Stipeal_shell YFB_stipe_center 0.741955 no
Pileal_Stipeal_shell YFB_stipe_shell 0.701346 no
Pileal_Stipeal_shell YFB_stipe_skin 0.902735 no
Pileal_Stipeal_shell YFB_cap_skin 0.872785 no
Pileal_Stipeal_shell YFB_cap_tissue 0.778227 no
Pileal_Stipeal_shell YFB_gill_tissue 0.967214 no
Pileal_Stipeal_shell YFB_veil 0.928651 no
Pileal_Stipeal_shell DIF_stipe_center 0.722781 no
Pileal_Stipeal_shell DIF_stipe_shell 0.698136 no
Pileal_Stipeal_shell DIF_stipe_skin 0.831965 no
Pileal_Stipeal_shell DIF_cap_skin 0.703700 no
Pileal_Stipeal_shell DIF_cap_tissue 0.823756 no
DIF_stipe_center DIF_gill_tissue 0.418972 no
DIF_stipe_center YFB_stipe_center 0.987961 no
DIF_stipe_center YFB_stipe_shell 0.987027 no
DIF_stipe_center YFB_stipe_skin 0.860956 no
DIF_stipe_center YFB_cap_skin 0.893666 no
DIF_stipe_center YFB_cap_tissue 0.409135 no
DIF_stipe_center YFB_gill_tissue 0.776502 no
DIF_stipe_center YFB_veil 0.593027 no
DIF_stipe_center DIF_stipe_shell 0.984982 no
DIF_stipe_center DIF_stipe_skin 0.929863 no
DIF_stipe_center DIF_cap_skin 0.337682 no
DIF_stipe_center DIF_cap_tissue 0.462401 no
DIF_stipe_shell DIF_gill_tissue 0.390574 no
DIF_stipe_shell YFB_stipe_center 0.973789 no
DIF_stipe_shell YFB_stipe_shell 0.998441 no
DIF_stipe_shell YFB_stipe_skin 0.839383 no
DIF_stipe_shell YFB_cap_skin 0.874179 no
DIF_stipe_shell YFB_cap_tissue 0.380708 no
DIF_stipe_shell YFB_gill_tissue 0.750923 no
DIF_stipe_shell YFB_veil 0.563074 no
DIF_stipe_shell DIF_stipe_skin 0.912764 no
DIF_stipe_shell DIF_cap_skin 0.313067 no
DIF_stipe_shell DIF_cap_tissue 0.434257 no
DIF_stipe_skin DIF_gill_tissue 0.532438 no
DIF_stipe_skin YFB_stipe_center 0.942823 no
DIF_stipe_skin YFB_stipe_shell 0.913413 no
DIF_stipe_skin YFB_stipe_skin 0.944383 no
DIF_stipe_skin YFB_cap_skin 0.969219 no
DIF_stipe_skin YFB_cap_tissue 0.525127 no
DIF_stipe_skin YFB_gill_tissue 0.875237 no
DIF_stipe_skin YFB_veil 0.712882 no
DIF_stipe_skin DIF_cap_skin 0.443576 no
DIF_stipe_skin DIF_cap_tissue 0.579377 no
DIF_cap_skin DIF_gill_tissue 0.946764 no
DIF_cap_skin YFB_stipe_center 0.362170 no
DIF_cap_skin YFB_stipe_shell 0.316787 no
DIF_cap_skin YFB_stipe_skin 0.539990 no
DIF_cap_skin YFB_cap_skin 0.502497 no
DIF_cap_skin YFB_cap_tissue 0.955471 no
DIF_cap_skin YFB_gill_tissue 0.643930 no
DIF_cap_skin YFB_veil 0.811887 no
DIF_cap_skin DIF_cap_tissue 0.912495 no
DIF_cap_tissue DIF_gill_tissue 0.972656 no
DIF_cap_tissue YFB_stipe_center 0.489964 no
DIF_cap_tissue YFB_stipe_shell 0.443576 no
DIF_cap_tissue YFB_stipe_skin 0.680139 no
DIF_cap_tissue YFB_cap_skin 0.635478 no
DIF_cap_tissue YFB_cap_tissue 0.966130 no
DIF_cap_tissue YFB_gill_tissue 0.772780 no
DIF_cap_tissue YFB_veil 0.919969 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|109580
MCISSNVYLLVHIIIVLAVTRKPPLVILLHGFPELAYSWRKVFVPLAKAGYHVIAPDQRGYGFTVPVASSSDPST
GSGYKRIVYDDDVRPYHLLNLAADVVHLIHALEYDRAYAVVGHDFGSSVAAWTALVRPDMIGRLVLMSAPFGGPP
KPRDAGSVRRKEESKAYLVDSLLKKLEVPRKHYTVYYSTPEANADMSYPPEGLTDFLRAYYHVKSADWEGNETPL
PTRLPLRLETTGSQPPSGAKITKAVAEAMEILPPYYVMPANLTMPEAVRQYFPASEQPCTCTWLTNEELQVYTSV
YGQTGFQGGLNRYRCMTDETWNAEPGVRALCGKKIEVPVRFIAGATDWGTWQYPGIAEAMRSESVVKGGIGDKDF
VVVEGAGHWVQQEKPEETVHALLQFFE*
Coding >AgabiH97|109580
ATGTGCATATCCTCGAATGTTTACCTCTTGGTACACATCATCATTGTCTTGGCAGTAACACGGAAACCACCACTC
GTGATACTCCTCCACGGTTTCCCAGAACTCGCATATTCCTGGCGCAAGGTGTTTGTACCTTTAGCAAAAGCAGGT
TATCACGTTATCGCGCCCGATCAGCGCGGATATGGGTTCACTGTTCCTGTCGCATCCTCCAGCGATCCAAGTACA
GGGTCTGGATACAAGCGCATCGTATACGACGACGACGTGCGGCCTTATCATCTTCTGAATCTCGCTGCAGATGTG
GTACACCTAATCCACGCGTTGGAGTACGATAGAGCTTATGCAGTGGTGGGGCATGATTTTGGATCATCAGTCGCC
GCATGGACAGCATTGGTTCGCCCAGACATGATTGGGCGACTTGTGTTGATGAGCGCACCGTTTGGTGGCCCGCCA
AAGCCACGAGATGCTGGAAGTGTGAGGAGAAAAGAGGAATCGAAAGCTTATTTGGTCGATTCGCTGCTGAAGAAA
CTGGAGGTGCCTAGAAAGCACTACACAGTGTATTATTCCACGCCAGAAGCGAATGCAGATATGAGCTATCCCCCA
GAAGGCCTCACAGATTTTTTGAGGGCCTACTATCACGTAAAAAGTGCGGATTGGGAGGGTAACGAAACACCACTT
CCTACACGTCTCCCCTTGAGACTCGAAACCACGGGTTCACAGCCTCCTTCAGGAGCAAAGATAACGAAAGCAGTT
GCGGAGGCGATGGAGATACTCCCGCCTTACTACGTCATGCCTGCCAATCTTACAATGCCAGAAGCTGTTCGGCAG
TATTTTCCGGCCTCCGAGCAACCATGCACATGCACGTGGCTCACCAACGAAGAGCTTCAGGTATATACATCCGTA
TATGGACAAACAGGATTCCAAGGGGGGCTAAATCGGTATCGTTGTATGACGGACGAGACATGGAATGCAGAACCG
GGTGTGAGAGCGTTATGTGGAAAAAAGATAGAGGTGCCAGTAAGGTTTATTGCTGGAGCTACAGACTGGGGGACT
TGGCAGTACCCAGGTATAGCGGAGGCGATGCGAAGTGAGAGCGTTGTGAAGGGTGGAATTGGCGATAAGGATTTT
GTGGTTGTAGAAGGGGCGGGACATTGGGTACAGCAGGAGAAACCTGAAGAGACGGTTCATGCACTACTCCAATTT
TTTGAGTAG
Transcript >AgabiH97|109580
ATGTGCATATCCTCGAATGTTTACCTCTTGGTACACATCATCATTGTCTTGGCAGTAACACGGAAACCACCACTC
GTGATACTCCTCCACGGTTTCCCAGAACTCGCATATTCCTGGCGCAAGGTGTTTGTACCTTTAGCAAAAGCAGGT
TATCACGTTATCGCGCCCGATCAGCGCGGATATGGGTTCACTGTTCCTGTCGCATCCTCCAGCGATCCAAGTACA
GGGTCTGGATACAAGCGCATCGTATACGACGACGACGTGCGGCCTTATCATCTTCTGAATCTCGCTGCAGATGTG
GTACACCTAATCCACGCGTTGGAGTACGATAGAGCTTATGCAGTGGTGGGGCATGATTTTGGATCATCAGTCGCC
GCATGGACAGCATTGGTTCGCCCAGACATGATTGGGCGACTTGTGTTGATGAGCGCACCGTTTGGTGGCCCGCCA
AAGCCACGAGATGCTGGAAGTGTGAGGAGAAAAGAGGAATCGAAAGCTTATTTGGTCGATTCGCTGCTGAAGAAA
CTGGAGGTGCCTAGAAAGCACTACACAGTGTATTATTCCACGCCAGAAGCGAATGCAGATATGAGCTATCCCCCA
GAAGGCCTCACAGATTTTTTGAGGGCCTACTATCACGTAAAAAGTGCGGATTGGGAGGGTAACGAAACACCACTT
CCTACACGTCTCCCCTTGAGACTCGAAACCACGGGTTCACAGCCTCCTTCAGGAGCAAAGATAACGAAAGCAGTT
GCGGAGGCGATGGAGATACTCCCGCCTTACTACGTCATGCCTGCCAATCTTACAATGCCAGAAGCTGTTCGGCAG
TATTTTCCGGCCTCCGAGCAACCATGCACATGCACGTGGCTCACCAACGAAGAGCTTCAGGTATATACATCCGTA
TATGGACAAACAGGATTCCAAGGGGGGCTAAATCGGTATCGTTGTATGACGGACGAGACATGGAATGCAGAACCG
GGTGTGAGAGCGTTATGTGGAAAAAAGATAGAGGTGCCAGTAAGGTTTATTGCTGGAGCTACAGACTGGGGGACT
TGGCAGTACCCAGGTATAGCGGAGGCGATGCGAAGTGAGAGCGTTGTGAAGGGTGGAATTGGCGATAAGGATTTT
GTGGTTGTAGAAGGGGCGGGACATTGGGTACAGCAGGAGAAACCTGAAGAGACGGTTCATGCACTACTCCAATTT
TTTGAGTAG
Gene >AgabiH97|109580
ATGTGCATATCCTCGAATGTTTACCTCTTGGTACACATCATCATTGTCTTGGCAGTAACACGGAAACCACCACTC
GTGATACTCCTCCACGGTTTCCCAGAACTCGCATATTCCTGGCGCAAGGTGTTTGTACCTTTAGCAAAAGCAGGT
TATCACGTTATCGCGCCCGATCAGCGCGGATATGGGTTCACTGTTCCTGTCGCATCCTCCAGCGATCCAAGTACA
GGGTCTGGATACAAGCGCATCGTATACGACGACGACGTGCGGCCTTATCATCTTCTGAATCTCGCTGCAGATGTG
GTACACCTAATCCACGCGTTGGAGTACGATAGAGCTTATGCAGTGGTGGGGCATGATTTTGGATCATCAGTCGCC
GCATGGACAGCATTGGTTCGCCCAGACATGATTGGGCGACTTGTGTTGATGAGCGCACCGTTTGGTGGCCCGCCA
AAGCCACGAGATGCTGGAAGTGTGAGGAGAAAAGAGGAATCGAAAGCTTATTTGGTCGATTCGCTGCTGAAGAAA
CTGGAGGTGCCTAGAAAGCACTACACAGTGTATTATTCCACGCCAGAAGCGAATGCAGATATGAGCTATCCCCCA
GAAGGCCTCACAGATTTTTTGAGGGCCTACTATCACGTAAAAAGTGCGGATTGGGAGGGTAACGAAACACCACTT
CCTACACGTCTCCCCTTGAGACTCGAAACCACGGGTTCACAGCCTCCTTCAGGAGCAAAGATAACGAAAGCAGTT
GCGGAGGCGATGGAGATACTCCCGCCTTACTACGTCATGCCTGCCAATCTTACAATGCCAGAAGCTGTTCGGCAG
TATTTTCCGGCCTCCGAGCAACCATGCACATGCACGTGGCTCACCAACGAAGAGCTTCAGGTATATACATCCGTA
TATGGACAAACAGGATTCCAAGGGGGGCTAAATCGGTATCGTTGTATGACGGACGAGACATGGAATGCAGAACCG
GGTGTGAGAGCGTTATGTGGAAAAAAGATAGAGGTGCCAGTAAGGTTTATTGCTGGAGCTACAGACTGGGGGACT
TGGCAGTACCCAGGTATAGCGGAGGCGATGCGAAGTGAGAGCGTTGTGAAGGGTGGAATTGGCGATAAGGATTTT
GTGGTTGTAGAAGGGGCGGGACATTGGGTACAGCAGGAGAAACCTGAAGAGACGGTTCATGCACTACTCCAATTT
TTTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail