Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|109580
Gene name
Locationscaffold_8:844299..845508
Strand+
Gene length (bp)1209
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 5.1E-19 24 146
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 5.6E-19 26 395
PF12146 Hydrolase_4 Serine aminopeptidase, S33 1.4E-08 25 183

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 24 402 4.0E-16
sp|O31581|YFHM_BACSU AB hydrolase superfamily protein YfhM OS=Bacillus subtilis (strain 168) GN=yfhM PE=3 SV=1 24 145 5.0E-16
sp|Q6IE26|EPHX4_MOUSE Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 SV=2 16 145 3.0E-12
sp|Q0IIS3|EPHX3_XENTR Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3 PE=2 SV=1 21 145 3.0E-11
sp|Q8IUS5|EPHX4_HUMAN Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2 16 145 8.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q2C2|HYES_PIG Bifunctional epoxide hydrolase 2 OS=Sus scrofa GN=EPHX2 PE=2 SV=1 24 402 4.0E-16
sp|O31581|YFHM_BACSU AB hydrolase superfamily protein YfhM OS=Bacillus subtilis (strain 168) GN=yfhM PE=3 SV=1 24 145 5.0E-16
sp|Q6IE26|EPHX4_MOUSE Epoxide hydrolase 4 OS=Mus musculus GN=Ephx4 PE=2 SV=2 16 145 3.0E-12
sp|Q0IIS3|EPHX3_XENTR Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3 PE=2 SV=1 21 145 3.0E-11
sp|Q8IUS5|EPHX4_HUMAN Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2 16 145 8.0E-11
sp|G5EBI4|CEEH1_CAEEL Epoxide hydrolase 1 OS=Caenorhabditis elegans GN=ceeh-1 PE=1 SV=1 24 153 5.0E-10
sp|P80299|HYES_RAT Bifunctional epoxide hydrolase 2 OS=Rattus norvegicus GN=Ephx2 PE=1 SV=1 24 402 7.0E-10
sp|P34913|HYES_HUMAN Bifunctional epoxide hydrolase 2 OS=Homo sapiens GN=EPHX2 PE=1 SV=2 24 146 2.0E-09
sp|P34914|HYES_MOUSE Bifunctional epoxide hydrolase 2 OS=Mus musculus GN=Ephx2 PE=1 SV=2 24 152 1.0E-07
sp|Q9H6B9|EPHX3_HUMAN Epoxide hydrolase 3 OS=Homo sapiens GN=EPHX3 PE=2 SV=1 24 144 2.0E-06
sp|Q3V1F8|EPHX3_MOUSE Epoxide hydrolase 3 OS=Mus musculus GN=Ephx3 PE=2 SV=2 24 145 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|109580
MCISSNVYLLVHIIIVLAVTRKPPLVILLHGFPELAYSWRKVFVPLAKAGYHVIAPDQRGYGFTVPVASSSDPST
GSGYKRIVYDDDVRPYHLLNLAADVVHLIHALEYDRAYAVVGHDFGSSVAAWTALVRPDMIGRLVLMSAPFGGPP
KPRDAGSVRRKEESKAYLVDSLLKKLEVPRKHYTVYYSTPEANADMSYPPEGLTDFLRAYYHVKSADWEGNETPL
PTRLPLRLETTGSQPPSGAKITKAVAEAMEILPPYYVMPANLTMPEAVRQYFPASEQPCTCTWLTNEELQVYTSV
YGQTGFQGGLNRYRCMTDETWNAEPGVRALCGKKIEVPVRFIAGATDWGTWQYPGIAEAMRSESVVKGGIGDKDF
VVVEGAGHWVQQEKPEETVHALLQFFE*
Coding >AgabiH97|109580
ATGTGCATATCCTCGAATGTTTACCTCTTGGTACACATCATCATTGTCTTGGCAGTAACACGGAAACCACCACTC
GTGATACTCCTCCACGGTTTCCCAGAACTCGCATATTCCTGGCGCAAGGTGTTTGTACCTTTAGCAAAAGCAGGT
TATCACGTTATCGCGCCCGATCAGCGCGGATATGGGTTCACTGTTCCTGTCGCATCCTCCAGCGATCCAAGTACA
GGGTCTGGATACAAGCGCATCGTATACGACGACGACGTGCGGCCTTATCATCTTCTGAATCTCGCTGCAGATGTG
GTACACCTAATCCACGCGTTGGAGTACGATAGAGCTTATGCAGTGGTGGGGCATGATTTTGGATCATCAGTCGCC
GCATGGACAGCATTGGTTCGCCCAGACATGATTGGGCGACTTGTGTTGATGAGCGCACCGTTTGGTGGCCCGCCA
AAGCCACGAGATGCTGGAAGTGTGAGGAGAAAAGAGGAATCGAAAGCTTATTTGGTCGATTCGCTGCTGAAGAAA
CTGGAGGTGCCTAGAAAGCACTACACAGTGTATTATTCCACGCCAGAAGCGAATGCAGATATGAGCTATCCCCCA
GAAGGCCTCACAGATTTTTTGAGGGCCTACTATCACGTAAAAAGTGCGGATTGGGAGGGTAACGAAACACCACTT
CCTACACGTCTCCCCTTGAGACTCGAAACCACGGGTTCACAGCCTCCTTCAGGAGCAAAGATAACGAAAGCAGTT
GCGGAGGCGATGGAGATACTCCCGCCTTACTACGTCATGCCTGCCAATCTTACAATGCCAGAAGCTGTTCGGCAG
TATTTTCCGGCCTCCGAGCAACCATGCACATGCACGTGGCTCACCAACGAAGAGCTTCAGGTATATACATCCGTA
TATGGACAAACAGGATTCCAAGGGGGGCTAAATCGGTATCGTTGTATGACGGACGAGACATGGAATGCAGAACCG
GGTGTGAGAGCGTTATGTGGAAAAAAGATAGAGGTGCCAGTAAGGTTTATTGCTGGAGCTACAGACTGGGGGACT
TGGCAGTACCCAGGTATAGCGGAGGCGATGCGAAGTGAGAGCGTTGTGAAGGGTGGAATTGGCGATAAGGATTTT
GTGGTTGTAGAAGGGGCGGGACATTGGGTACAGCAGGAGAAACCTGAAGAGACGGTTCATGCACTACTCCAATTT
TTTGAGTAG
Transcript >AgabiH97|109580
ATGTGCATATCCTCGAATGTTTACCTCTTGGTACACATCATCATTGTCTTGGCAGTAACACGGAAACCACCACTC
GTGATACTCCTCCACGGTTTCCCAGAACTCGCATATTCCTGGCGCAAGGTGTTTGTACCTTTAGCAAAAGCAGGT
TATCACGTTATCGCGCCCGATCAGCGCGGATATGGGTTCACTGTTCCTGTCGCATCCTCCAGCGATCCAAGTACA
GGGTCTGGATACAAGCGCATCGTATACGACGACGACGTGCGGCCTTATCATCTTCTGAATCTCGCTGCAGATGTG
GTACACCTAATCCACGCGTTGGAGTACGATAGAGCTTATGCAGTGGTGGGGCATGATTTTGGATCATCAGTCGCC
GCATGGACAGCATTGGTTCGCCCAGACATGATTGGGCGACTTGTGTTGATGAGCGCACCGTTTGGTGGCCCGCCA
AAGCCACGAGATGCTGGAAGTGTGAGGAGAAAAGAGGAATCGAAAGCTTATTTGGTCGATTCGCTGCTGAAGAAA
CTGGAGGTGCCTAGAAAGCACTACACAGTGTATTATTCCACGCCAGAAGCGAATGCAGATATGAGCTATCCCCCA
GAAGGCCTCACAGATTTTTTGAGGGCCTACTATCACGTAAAAAGTGCGGATTGGGAGGGTAACGAAACACCACTT
CCTACACGTCTCCCCTTGAGACTCGAAACCACGGGTTCACAGCCTCCTTCAGGAGCAAAGATAACGAAAGCAGTT
GCGGAGGCGATGGAGATACTCCCGCCTTACTACGTCATGCCTGCCAATCTTACAATGCCAGAAGCTGTTCGGCAG
TATTTTCCGGCCTCCGAGCAACCATGCACATGCACGTGGCTCACCAACGAAGAGCTTCAGGTATATACATCCGTA
TATGGACAAACAGGATTCCAAGGGGGGCTAAATCGGTATCGTTGTATGACGGACGAGACATGGAATGCAGAACCG
GGTGTGAGAGCGTTATGTGGAAAAAAGATAGAGGTGCCAGTAAGGTTTATTGCTGGAGCTACAGACTGGGGGACT
TGGCAGTACCCAGGTATAGCGGAGGCGATGCGAAGTGAGAGCGTTGTGAAGGGTGGAATTGGCGATAAGGATTTT
GTGGTTGTAGAAGGGGCGGGACATTGGGTACAGCAGGAGAAACCTGAAGAGACGGTTCATGCACTACTCCAATTT
TTTGAGTAG
Gene >AgabiH97|109580
ATGTGCATATCCTCGAATGTTTACCTCTTGGTACACATCATCATTGTCTTGGCAGTAACACGGAAACCACCACTC
GTGATACTCCTCCACGGTTTCCCAGAACTCGCATATTCCTGGCGCAAGGTGTTTGTACCTTTAGCAAAAGCAGGT
TATCACGTTATCGCGCCCGATCAGCGCGGATATGGGTTCACTGTTCCTGTCGCATCCTCCAGCGATCCAAGTACA
GGGTCTGGATACAAGCGCATCGTATACGACGACGACGTGCGGCCTTATCATCTTCTGAATCTCGCTGCAGATGTG
GTACACCTAATCCACGCGTTGGAGTACGATAGAGCTTATGCAGTGGTGGGGCATGATTTTGGATCATCAGTCGCC
GCATGGACAGCATTGGTTCGCCCAGACATGATTGGGCGACTTGTGTTGATGAGCGCACCGTTTGGTGGCCCGCCA
AAGCCACGAGATGCTGGAAGTGTGAGGAGAAAAGAGGAATCGAAAGCTTATTTGGTCGATTCGCTGCTGAAGAAA
CTGGAGGTGCCTAGAAAGCACTACACAGTGTATTATTCCACGCCAGAAGCGAATGCAGATATGAGCTATCCCCCA
GAAGGCCTCACAGATTTTTTGAGGGCCTACTATCACGTAAAAAGTGCGGATTGGGAGGGTAACGAAACACCACTT
CCTACACGTCTCCCCTTGAGACTCGAAACCACGGGTTCACAGCCTCCTTCAGGAGCAAAGATAACGAAAGCAGTT
GCGGAGGCGATGGAGATACTCCCGCCTTACTACGTCATGCCTGCCAATCTTACAATGCCAGAAGCTGTTCGGCAG
TATTTTCCGGCCTCCGAGCAACCATGCACATGCACGTGGCTCACCAACGAAGAGCTTCAGGTATATACATCCGTA
TATGGACAAACAGGATTCCAAGGGGGGCTAAATCGGTATCGTTGTATGACGGACGAGACATGGAATGCAGAACCG
GGTGTGAGAGCGTTATGTGGAAAAAAGATAGAGGTGCCAGTAAGGTTTATTGCTGGAGCTACAGACTGGGGGACT
TGGCAGTACCCAGGTATAGCGGAGGCGATGCGAAGTGAGAGCGTTGTGAAGGGTGGAATTGGCGATAAGGATTTT
GTGGTTGTAGAAGGGGCGGGACATTGGGTACAGCAGGAGAAACCTGAAGAGACGGTTCATGCACTACTCCAATTT
TTTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail