Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|109530
Gene name
Locationscaffold_8:827782..830463
Strand-
Gene length (bp)2681
Transcript length (bp)2511
Coding sequence length (bp)2511
Protein length (aa) 837

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 4.7E-08 633 726

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4606 0.9079 0.0184 0.0275 0.2851 0.0003 0.0754 0.0669 0.04 0.0114

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup4943
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|109530
Agaricus bisporus var bisporus H97 AgabiH97|109530 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|109530
MSFQSSPSPSAGSQQQTNSPMPPASSLQMQMNLMQNLMQFQNVGEQMLGMSGQQTQFDGSPSMAYNPPAALVEQQ
FKINQLQQLQQLQNQIFQHQIALISGQSILPAGHSMNRNDFSSNSLPLSAMKDQSFTSTSPHNSYPGLPTPGPST
EIRPRDSPMEFVPPMVLGADSLFDPPISPQSTHDTSHISYPHSHSSGTPHFHAHTAPPQVVFDIRSEMTPNSSGA
DGLSSGSLSNVPLLSNGADNDLDISPLTSPWLGAGSHQRSSVGTDSGLHPHHVRSASFSHLGRSSSKRPADRGCS
RDLNSAHGMFESEPARKKHSPDSPSAPRGMNSQQQYQHMTPLTLLPQPNSPLSSPISPLTTAINATNLVTGTGTC
SSSSSASGTNSQRRTYRGSMSTGNTPLLRGQRSRVSSNTRGQANNNSSNNTSTSLTGTPSSVSIGNGAGTFVADT
PSPVDLAMPPPAPPGHVMNSSPSGSGSGSGSNSNQDMDGMGPGGVLLPVTPASIMKLGKLGPSNNNHNNDGDGGG
HASVPRSWPGEPRDDKKGGGAGEKDKDNGGGKGNRNGSGSAAGGAPTSIAASRTRRNTASTTAATGGVSGSGLKT
ILPANPSYSPQISASAGVSSRSNDQDSQQQLPRKTSHKAAEQKRRDSLKTAYDELRTLLPPIPLSSDMDESALAN
GFGIPGAWPPRSSSSLPGSLPPRGPPKTGAEGPNKGVSKLQLLICGNEFIRVLKKRVERRDEEIIKLRDEVGKLR
CLVGDMKLGGDGNDMEEDRRRHNEGDYGIRGSFAGGSFDFDWDLDLEKDLDAVEMHNSDANEECGNIGGMMGGMG
MGTGVVNVGLS*
Coding >AgabiH97|109530
ATGTCTTTCCAGTCCTCGCCGAGCCCGTCGGCAGGCTCGCAGCAGCAGACAAACTCTCCCATGCCGCCCGCATCG
AGTCTCCAGATGCAGATGAATCTCATGCAAAATCTCATGCAATTCCAGAACGTCGGTGAACAGATGCTGGGTATG
TCGGGTCAACAAACACAGTTCGATGGCTCTCCAAGTATGGCATACAACCCGCCAGCTGCCTTGGTCGAGCAGCAG
TTTAAAATCAATCAACTACAACAGCTTCAACAACTTCAAAACCAGATATTCCAGCACCAGATTGCTCTAATATCC
GGACAGTCTATTCTTCCAGCGGGACACTCAATGAACCGAAACGATTTCTCTTCCAACTCGCTACCTCTTTCAGCA
ATGAAAGACCAAAGTTTTACTTCCACATCACCTCATAACTCTTATCCTGGGCTTCCCACCCCAGGACCGTCCACG
GAAATCCGACCGCGGGACAGCCCGATGGAATTCGTTCCCCCAATGGTACTTGGGGCAGACTCGTTATTCGACCCT
CCTATATCTCCCCAATCCACTCACGATACCAGCCATATATCCTATCCGCATTCCCATTCATCGGGAACCCCACAT
TTTCATGCGCATACGGCACCGCCACAAGTTGTTTTTGATATCCGGTCGGAAATGACCCCAAATAGTTCTGGTGCC
GATGGGCTCTCATCTGGATCGCTTTCCAATGTGCCTTTGTTGTCCAACGGAGCGGACAATGATCTTGACATCTCG
CCACTTACGAGTCCCTGGTTGGGTGCTGGGAGTCATCAACGATCATCGGTCGGGACTGATTCGGGACTTCATCCA
CATCACGTTCGTTCGGCCAGTTTTTCCCATTTAGGGAGGTCGAGTTCAAAACGGCCTGCAGATAGGGGCTGTTCT
AGAGACTTGAACAGTGCGCATGGCATGTTCGAATCTGAACCTGCGCGAAAGAAGCATAGCCCGGATTCTCCATCA
GCTCCACGGGGTATGAACTCGCAGCAGCAATACCAGCATATGACACCGTTAACGCTCCTCCCCCAACCCAACTCA
CCACTTTCGTCACCGATATCACCTTTGACGACGGCAATAAACGCTACTAACCTGGTGACTGGTACTGGAACCTGT
TCGTCTTCATCATCTGCTTCTGGCACAAATTCTCAGAGAAGAACGTATCGAGGCTCAATGTCCACCGGTAACACC
CCCTTACTACGTGGTCAACGATCAAGAGTCAGCAGTAACACGCGTGGCCAGGCCAACAATAATTCTTCGAATAAC
ACGAGTACGAGTTTGACGGGTACACCTTCGTCTGTGAGCATTGGGAATGGAGCTGGAACGTTTGTTGCGGACACA
CCTTCACCTGTGGATCTTGCTATGCCACCACCTGCACCTCCCGGCCACGTTATGAATTCTAGTCCCTCTGGCTCT
GGCTCCGGCTCCGGTTCGAATTCGAATCAGGATATGGATGGAATGGGTCCCGGTGGAGTGCTACTGCCAGTCACA
CCGGCGAGTATCATGAAACTCGGGAAACTCGGTCCGAGTAACAATAACCATAACAACGATGGCGACGGCGGCGGT
CATGCTTCTGTTCCTCGTTCTTGGCCAGGTGAGCCCCGTGACGACAAGAAAGGGGGTGGGGCGGGGGAGAAGGAC
AAGGATAATGGTGGTGGAAAAGGTAATCGGAATGGTAGTGGTTCTGCAGCTGGTGGTGCGCCTACTAGCATCGCA
GCTAGTCGGACGAGGAGAAACACCGCTTCTACTACCGCCGCCACGGGTGGAGTTTCTGGTTCCGGCCTCAAGACT
ATCTTACCTGCCAATCCTTCTTATTCTCCTCAAATATCCGCTTCTGCTGGTGTGTCATCAAGAAGTAATGACCAG
GACAGCCAACAACAACTACCTCGTAAGACTTCTCACAAAGCCGCGGAGCAGAAACGTAGAGATTCTTTGAAAACC
GCTTATGATGAATTACGTACTCTCCTTCCGCCTATACCCCTGTCATCCGATATGGATGAATCTGCTCTAGCGAAT
GGATTTGGTATTCCAGGAGCATGGCCACCTCGCTCGTCATCATCGTTACCTGGATCTTTACCGCCACGAGGACCT
CCGAAAACTGGAGCTGAAGGTCCCAATAAGGGAGTCAGCAAACTGCAGCTCTTGATTTGTGGGAACGAGTTTATC
AGGGTTTTGAAGAAGAGAGTTGAGAGGAGGGATGAGGAGATTATCAAGTTGAGAGATGAGGTTGGGAAATTGAGG
TGTTTGGTTGGGGATATGAAGCTCGGAGGTGACGGTAACGATATGGAAGAGGATAGGAGGAGACACAATGAAGGA
GATTATGGAATACGAGGTTCTTTTGCTGGTGGAAGCTTTGATTTCGATTGGGATCTGGATTTGGAGAAAGATTTG
GATGCGGTCGAAATGCATAACAGTGATGCGAACGAGGAATGTGGAAATATTGGAGGGATGATGGGTGGAATGGGA
ATGGGAACTGGTGTGGTGAATGTGGGATTGAGCTGA
Transcript >AgabiH97|109530
ATGTCTTTCCAGTCCTCGCCGAGCCCGTCGGCAGGCTCGCAGCAGCAGACAAACTCTCCCATGCCGCCCGCATCG
AGTCTCCAGATGCAGATGAATCTCATGCAAAATCTCATGCAATTCCAGAACGTCGGTGAACAGATGCTGGGTATG
TCGGGTCAACAAACACAGTTCGATGGCTCTCCAAGTATGGCATACAACCCGCCAGCTGCCTTGGTCGAGCAGCAG
TTTAAAATCAATCAACTACAACAGCTTCAACAACTTCAAAACCAGATATTCCAGCACCAGATTGCTCTAATATCC
GGACAGTCTATTCTTCCAGCGGGACACTCAATGAACCGAAACGATTTCTCTTCCAACTCGCTACCTCTTTCAGCA
ATGAAAGACCAAAGTTTTACTTCCACATCACCTCATAACTCTTATCCTGGGCTTCCCACCCCAGGACCGTCCACG
GAAATCCGACCGCGGGACAGCCCGATGGAATTCGTTCCCCCAATGGTACTTGGGGCAGACTCGTTATTCGACCCT
CCTATATCTCCCCAATCCACTCACGATACCAGCCATATATCCTATCCGCATTCCCATTCATCGGGAACCCCACAT
TTTCATGCGCATACGGCACCGCCACAAGTTGTTTTTGATATCCGGTCGGAAATGACCCCAAATAGTTCTGGTGCC
GATGGGCTCTCATCTGGATCGCTTTCCAATGTGCCTTTGTTGTCCAACGGAGCGGACAATGATCTTGACATCTCG
CCACTTACGAGTCCCTGGTTGGGTGCTGGGAGTCATCAACGATCATCGGTCGGGACTGATTCGGGACTTCATCCA
CATCACGTTCGTTCGGCCAGTTTTTCCCATTTAGGGAGGTCGAGTTCAAAACGGCCTGCAGATAGGGGCTGTTCT
AGAGACTTGAACAGTGCGCATGGCATGTTCGAATCTGAACCTGCGCGAAAGAAGCATAGCCCGGATTCTCCATCA
GCTCCACGGGGTATGAACTCGCAGCAGCAATACCAGCATATGACACCGTTAACGCTCCTCCCCCAACCCAACTCA
CCACTTTCGTCACCGATATCACCTTTGACGACGGCAATAAACGCTACTAACCTGGTGACTGGTACTGGAACCTGT
TCGTCTTCATCATCTGCTTCTGGCACAAATTCTCAGAGAAGAACGTATCGAGGCTCAATGTCCACCGGTAACACC
CCCTTACTACGTGGTCAACGATCAAGAGTCAGCAGTAACACGCGTGGCCAGGCCAACAATAATTCTTCGAATAAC
ACGAGTACGAGTTTGACGGGTACACCTTCGTCTGTGAGCATTGGGAATGGAGCTGGAACGTTTGTTGCGGACACA
CCTTCACCTGTGGATCTTGCTATGCCACCACCTGCACCTCCCGGCCACGTTATGAATTCTAGTCCCTCTGGCTCT
GGCTCCGGCTCCGGTTCGAATTCGAATCAGGATATGGATGGAATGGGTCCCGGTGGAGTGCTACTGCCAGTCACA
CCGGCGAGTATCATGAAACTCGGGAAACTCGGTCCGAGTAACAATAACCATAACAACGATGGCGACGGCGGCGGT
CATGCTTCTGTTCCTCGTTCTTGGCCAGGTGAGCCCCGTGACGACAAGAAAGGGGGTGGGGCGGGGGAGAAGGAC
AAGGATAATGGTGGTGGAAAAGGTAATCGGAATGGTAGTGGTTCTGCAGCTGGTGGTGCGCCTACTAGCATCGCA
GCTAGTCGGACGAGGAGAAACACCGCTTCTACTACCGCCGCCACGGGTGGAGTTTCTGGTTCCGGCCTCAAGACT
ATCTTACCTGCCAATCCTTCTTATTCTCCTCAAATATCCGCTTCTGCTGGTGTGTCATCAAGAAGTAATGACCAG
GACAGCCAACAACAACTACCTCGTAAGACTTCTCACAAAGCCGCGGAGCAGAAACGTAGAGATTCTTTGAAAACC
GCTTATGATGAATTACGTACTCTCCTTCCGCCTATACCCCTGTCATCCGATATGGATGAATCTGCTCTAGCGAAT
GGATTTGGTATTCCAGGAGCATGGCCACCTCGCTCGTCATCATCGTTACCTGGATCTTTACCGCCACGAGGACCT
CCGAAAACTGGAGCTGAAGGTCCCAATAAGGGAGTCAGCAAACTGCAGCTCTTGATTTGTGGGAACGAGTTTATC
AGGGTTTTGAAGAAGAGAGTTGAGAGGAGGGATGAGGAGATTATCAAGTTGAGAGATGAGGTTGGGAAATTGAGG
TGTTTGGTTGGGGATATGAAGCTCGGAGGTGACGGTAACGATATGGAAGAGGATAGGAGGAGACACAATGAAGGA
GATTATGGAATACGAGGTTCTTTTGCTGGTGGAAGCTTTGATTTCGATTGGGATCTGGATTTGGAGAAAGATTTG
GATGCGGTCGAAATGCATAACAGTGATGCGAACGAGGAATGTGGAAATATTGGAGGGATGATGGGTGGAATGGGA
ATGGGAACTGGTGTGGTGAATGTGGGATTGAGCTGA
Gene >AgabiH97|109530
ATGTCTTTCCAGTCCTCGCCGAGCCCGTCGGCAGGCTCGCAGCAGCAGACAAACTCTCCCATGCCGCCCGCATCG
AGTCTCCAGATGCAGATGAATCTCATGCAAAATCTCATGCAATTCCAGAACGTCGGTGAACAGATGCTGGGTATG
TCGGGTCAACAAACACAGTTCGATGGCTCTCCAAGTATGGCATACAACCCGCCAGCTGCCTTGGTCGAGCAGCAG
TTTAAAATCAATCAACTACAACAGCTTCAACAACTTCAAAACCAGATATTCCAGCACCAGGTCCGTCGTTCGCCA
TCGTTTTGTTCGGACACTCCCCGCTGAAAGATTCGAGTCAGATTGCTCTAATATCCGGACAGTCTATTCTTCCAG
CGGGACACTCAATGAACCGAAACGATTTCTCTTCCAACTCGCTACCTCTTTCAGCAATGAAAGACCAAAGTTTTA
CTTCCACATCACCTCATAACTCTTATCCTGGGCTTCCCACCCCAGGTGCGTACGGTTTGTTCGTTATGAGATTAC
GTCGTATTGTAACAGAAAACATTCATCAGGACCGTCCACGGAAATCCGACCGCGGGACAGCCCGATGGAATTCGT
TCCCCCAATGGTACTTGGGGCAGACTCGTTATTCGACCCTCCTATATCTCCCCAATCCACTCACGATACCAGCCA
TATATCCTATCCGCATTCCCATTCATCGGGAACCCCACATTTTCATGCGCATACGGCACCGCCACAAGTTGTTTT
TGATATCCGGTCGGAAATGACCCCAAATAGTTCTGGTGCCGATGGGCTCTCATCTGGATCGCTTTCCAATGTGCC
TTTGTTGTCCAACGGAGCGGACAATGATCTTGACATCTCGCCACTTACGAGTCCCTGGTTGGGTGCTGGGAGTCA
TCAACGATCATCGGTCGGGACTGATTCGGGACTTCATCCACATCACGTTCGTTCGGCCAGTTTTTCCCATTTAGG
GAGGTCGAGTTCAAAACGGCCTGCAGATAGGGGCTGTTCTAGAGACTTGAACAGTGCGCATGGCATGTTCGAATC
TGAACCTGCGCGAAAGAAGCATAGCCCGGATTCTCCATCAGCTCCACGGGGTATGAACTCGCAGCAGCAATACCA
GCATATGACACCGTTAACGCTCCTCCCCCAACCCAACTCACCACTTTCGTCACCGATATCACCTTTGACGACGGC
AATAAACGCTACTAACCTGGTGACTGGTACTGGAACCTGTTCGTCTTCATCATCTGCTTCTGGCACAAATTCTCA
GAGAAGAACGTATCGAGGCTCAATGTCCACCGGTAACACCCCCTTACTACGTGGTCAACGATCAAGAGTCAGCAG
TAACACGCGTGGCCAGGCCAACAATAATTCTTCGAATAACACGAGTACGAGTTTGACGGGTACACCTTCGTCTGT
GAGCATTGGGAATGGAGCTGGAACGTTTGTTGCGGACACACCTTCACCTGTGGATCTTGCTATGCCACCACCTGC
ACCTCCCGGCCACGTTATGAATTCTAGTCCCTCTGGCTCTGGCTCCGGCTCCGGTTCGAATTCGAATCAGGATAT
GGATGGAATGGGTCCCGGTGGAGTGCTACTGCCAGTCACACCGGCGAGTATCATGAAACTCGGGAAACTCGGTCC
GAGTAACAATAACCATAACAACGATGGCGACGGCGGCGGTCATGCTTCTGTTCCTCGTTCTTGGCCAGGTGAGCC
CCGTGACGACAAGAAAGGGGGTGGGGCGGGGGAGAAGGACAAGGATAATGGTGGTGGAAAAGGTAATCGGAATGG
TAGTGGTTCTGCAGCTGGTGGTGCGCCTACTAGCATCGCAGCTAGTCGGACGAGGAGAAACACCGCTTCTACTAC
CGCCGCCACGGGTGGAGTTTCTGGTTCCGGCCTCAAGACTATCTTACCTGGTACGTCTACTTGTCCTCAAATTTC
AAACTGAATTTGACGGCCATTTATTTGTAGCCAATCCTTCTTATTCTCCTCAAATATCCGCTTCTGCTGGTGTGT
CATCAAGAAGTAATGACCAGGACAGCCAACAACAACTACCTCGTAAGACTTCTCACAAAGCCGCGGAGCAGAAAC
GTAGAGATTCTTTGAAAACCGCTTATGATGAATTACGTACTCTCCTTCCGCCTATACCCCTGTCATCCGATATGG
ATGAATCTGCTCTAGCGAATGGATTTGGTATTCCAGGAGCATGGCCACCTCGCTCGTCATCATCGTTACCTGGAT
CTTTACCGCCACGAGGACCTCCGAAAACTGGAGCTGAAGGTCCCAATAAGGGAGTCAGCAAACTGCAGCTCTTGA
TTTGTGGGAACGAGTTTATCAGGGTTTTGAAGAAGAGAGTTGAGAGGAGGGATGAGGAGATTATCAAGTTGAGAG
ATGAGGTTGGGAAATTGAGGTGTTTGGTTGGGGATATGAAGCTCGGAGGTGACGGTAACGATATGGAAGAGGATA
GGAGGAGACACAATGAAGGAGATTATGGAATACGAGGTTCTTTTGCTGGTGGAAGCTTTGATTTCGATTGGGATC
TGGATTTGGAGAAAGATTTGGATGCGGTCGAAATGCATAACAGTGATGCGAACGAGGAATGTGGAAATATTGGAG
GGATGATGGGTGGAATGGGAATGGGAACTGGTGTGGTGAATGTGGGATTGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail