© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|109430 |
| Gene name | |
| Location | scaffold_8:808885..809805 |
| Strand | + |
| Gene length (bp) | 920 |
| Transcript length (bp) | 690 |
| Coding sequence length (bp) | 690 |
| Protein length (aa) | 230 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF01183 | Glyco_hydro_25 | Glycosyl hydrolases family 25 | 1.5E-53 | 26 | 210 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P25310|LYSM1_STRGL | Lysozyme M1 OS=Streptomyces globisporus GN=acm PE=1 SV=1 | 23 | 226 | 5.0E-72 |
| sp|P00721|LYS_CHASP | N,O-diacetylmuramidase OS=Chalaropsis sp. PE=1 SV=1 | 22 | 228 | 2.0E-70 |
| sp|D4ANU4|LYS_ARTBC | N,O-diacetylmuramidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05911 PE=1 SV=1 | 16 | 228 | 2.0E-69 |
| sp|Q8FFY2|YEGX_ECOL6 | Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yegX PE=3 SV=2 | 22 | 223 | 2.0E-21 |
| sp|P26836|LYS_CLOPE | Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) GN=lyc PE=3 SV=2 | 23 | 210 | 6.0E-21 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P25310|LYSM1_STRGL | Lysozyme M1 OS=Streptomyces globisporus GN=acm PE=1 SV=1 | 23 | 226 | 5.0E-72 |
| sp|P00721|LYS_CHASP | N,O-diacetylmuramidase OS=Chalaropsis sp. PE=1 SV=1 | 22 | 228 | 2.0E-70 |
| sp|D4ANU4|LYS_ARTBC | N,O-diacetylmuramidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05911 PE=1 SV=1 | 16 | 228 | 2.0E-69 |
| sp|Q8FFY2|YEGX_ECOL6 | Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yegX PE=3 SV=2 | 22 | 223 | 2.0E-21 |
| sp|P26836|LYS_CLOPE | Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) GN=lyc PE=3 SV=2 | 23 | 210 | 6.0E-21 |
| sp|P76421|YEGX_ECOLI | Uncharacterized protein YegX OS=Escherichia coli (strain K12) GN=yegX PE=3 SV=2 | 22 | 228 | 2.0E-20 |
| sp|Q8X7H0|YEGX_ECO57 | Uncharacterized protein YegX OS=Escherichia coli O157:H7 GN=yegX PE=3 SV=2 | 22 | 228 | 2.0E-19 |
| sp|P34020|LYS_CLOAB | Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lyc PE=1 SV=1 | 23 | 210 | 2.0E-18 |
| sp|Q86KC1|LYSG2_DICDI | Probable GH family 25 lysozyme 2 OS=Dictyostelium discoideum GN=DDB_G0274181 PE=3 SV=1 | 5 | 206 | 3.0E-07 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0016998 | cell wall macromolecule catabolic process | Yes |
| GO:0009253 | peptidoglycan catabolic process | Yes |
| GO:0003796 | lysozyme activity | Yes |
| GO:1901575 | organic substance catabolic process | No |
| GO:0043170 | macromolecule metabolic process | No |
| GO:0030203 | glycosaminoglycan metabolic process | No |
| GO:0008152 | metabolic process | No |
| GO:0009056 | catabolic process | No |
| GO:0008150 | biological_process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:1901565 | organonitrogen compound catabolic process | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:0044248 | cellular catabolic process | No |
| GO:0061783 | peptidoglycan muralytic activity | No |
| GO:0006026 | aminoglycan catabolic process | No |
| GO:0016787 | hydrolase activity | No |
| GO:0006022 | aminoglycan metabolic process | No |
| GO:0016798 | hydrolase activity, acting on glycosyl bonds | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:1901135 | carbohydrate derivative metabolic process | No |
| GO:0000270 | peptidoglycan metabolic process | No |
| GO:0003674 | molecular_function | No |
| GO:0044036 | cell wall macromolecule metabolic process | No |
| GO:1901136 | carbohydrate derivative catabolic process | No |
| GO:0009987 | cellular process | No |
| GO:0006027 | glycosaminoglycan catabolic process | No |
| GO:0003824 | catalytic activity | No |
| GO:0044265 | cellular macromolecule catabolic process | No |
| GO:0009057 | macromolecule catabolic process | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0044260 | cellular macromolecule metabolic process | No |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Extracellular | Signal peptide | 0.2099 | 0.0668 | 0.9174 | 0.0775 | 0.104 | 0.0454 | 0.2409 | 0.2888 | 0.0792 | 0.0124 |
| SignalP signal predicted | Location | Score |
|---|---|---|
| Yes | 1 - 25 | 0.999802 |
| CAZyme category | E-value | Start | End |
|---|---|---|---|
| GH25 | 1.6E-55 | 26 | 210 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 53.00 | 22.75 | 83.24 |
| Initials | Initials knots | 25.52 | 12.66 | 38.38 |
| Pileal_Stipeal_center | Stage I stipe center | 17.01 | 7.52 | 26.50 |
| Pileal_Stipeal_shell | Stage I stipe shell | 17.63 | 8.22 | 27.04 |
| DIF_stipe_center | Stage II stipe center | 15.24 | 7.00 | 23.48 |
| DIF_stipe_shell | Stage II stipe shell | 13.79 | 6.25 | 21.33 |
| DIF_stipe_skin | Stage II stipe skin | 14.19 | 6.46 | 21.91 |
| DIF_cap_skin | Stage II cap skin | 12.87 | 5.79 | 19.95 |
| DIF_cap_tissue | Stage II cap tissue | 14.11 | 6.43 | 21.79 |
| DIF_gill_tissue | Stage II gill tissue | 16.97 | 7.91 | 26.02 |
| YFB_stipe_center | Young fruiting body stipe center | 15.77 | 7.26 | 24.28 |
| YFB_stipe_shell | Young fruiting body stipe shell | 14.95 | 6.81 | 23.09 |
| YFB_stipe_skin | Young fruiting body stipe skin | 12.31 | 5.46 | 19.16 |
| YFB_cap_skin | Young fruiting body cap skin | 10.29 | 4.46 | 16.11 |
| YFB_cap_tissue | Young fruiting body cap tissue | 15.39 | 7.11 | 23.67 |
| YFB_gill_tissue | Young fruiting body gill tissue | 12.93 | 5.80 | 20.06 |
| YFB_veil | Young fruiting body veil | 12.45 | 5.57 | 19.33 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.000613 | yes |
| Casing | YFB_stipe_center | 0.000613 | yes |
| Casing | YFB_stipe_shell | 0.000613 | yes |
| Casing | YFB_stipe_skin | 0.000613 | yes |
| Casing | YFB_cap_skin | 0.000613 | yes |
| Casing | YFB_cap_tissue | 0.000613 | yes |
| Casing | YFB_gill_tissue | 0.000613 | yes |
| Casing | YFB_veil | 0.000613 | yes |
| Casing | Initials | 0.039612 | yes |
| Casing | Pileal_Stipeal_center | 0.000613 | yes |
| Casing | Pileal_Stipeal_shell | 0.001140 | yes |
| Casing | DIF_stipe_center | 0.000613 | yes |
| Casing | DIF_stipe_shell | 0.000613 | yes |
| Casing | DIF_stipe_skin | 0.000613 | yes |
| Casing | DIF_cap_skin | 0.000613 | yes |
| Casing | DIF_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.914807 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.839352 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.485354 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.221143 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.882578 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.573368 | no |
| DIF_gill_tissue | YFB_veil | 0.504690 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.942655 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.640217 | no |
| YFB_stipe_center | YFB_cap_skin | 0.341853 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.974007 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.726665 | no |
| YFB_stipe_center | YFB_veil | 0.661161 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.732888 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.422068 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.968938 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.815431 | no |
| YFB_stipe_shell | YFB_veil | 0.753266 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.764358 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.680139 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.946209 | no |
| YFB_stipe_skin | YFB_veil | 0.987947 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.364099 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.678313 | no |
| YFB_cap_skin | YFB_veil | 0.745087 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.766457 | no |
| YFB_cap_tissue | YFB_veil | 0.698817 | no |
| YFB_gill_tissue | YFB_veil | 0.957888 | no |
| Initials | DIF_gill_tissue | 0.309271 | no |
| Initials | YFB_stipe_center | 0.217100 | no |
| Initials | YFB_stipe_shell | 0.153146 | no |
| Initials | YFB_stipe_skin | 0.037364 | yes |
| Initials | YFB_cap_skin | 0.009446 | yes |
| Initials | YFB_cap_tissue | 0.186312 | no |
| Initials | YFB_gill_tissue | 0.055381 | no |
| Initials | YFB_veil | 0.039390 | yes |
| Initials | Pileal_Stipeal_center | 0.321898 | no |
| Initials | Pileal_Stipeal_shell | 0.366791 | no |
| Initials | DIF_stipe_center | 0.178332 | no |
| Initials | DIF_stipe_shell | 0.089641 | no |
| Initials | DIF_stipe_skin | 0.107930 | no |
| Initials | DIF_cap_skin | 0.046952 | yes |
| Initials | DIF_cap_tissue | 0.111181 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.996319 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.913716 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.839569 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.492381 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.228362 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.883295 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.576983 | no |
| Pileal_Stipeal_center | YFB_veil | 0.511613 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.959464 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.867919 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.698000 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.753040 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.566262 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.744147 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.956140 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.859524 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.772524 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.412221 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.174105 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.823412 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.498178 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.433516 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.807003 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.621523 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.678191 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.490031 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.672031 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.868156 | no |
| DIF_stipe_center | YFB_stipe_center | 0.962748 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.979508 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.694804 | no |
| DIF_stipe_center | YFB_cap_skin | 0.389457 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.988804 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.781116 | no |
| DIF_stipe_center | YFB_veil | 0.714849 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.880633 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.919218 | no |
| DIF_stipe_center | DIF_cap_skin | 0.774188 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.912615 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.702338 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.832100 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.906722 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.862994 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.567612 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.870176 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.928804 | no |
| DIF_stipe_shell | YFB_veil | 0.878518 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.969893 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.923027 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.975361 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.753818 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.875284 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.943631 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.821698 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.517429 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.909230 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.892813 | no |
| DIF_stipe_skin | YFB_veil | 0.839876 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.887570 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.994203 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.575547 | no |
| DIF_cap_skin | YFB_stipe_center | 0.721293 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.807384 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.952184 | no |
| DIF_cap_skin | YFB_cap_skin | 0.693243 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.762646 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.994225 | no |
| DIF_cap_skin | YFB_veil | 0.963352 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.893840 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.741726 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.866847 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.935884 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.829027 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.525365 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.902563 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.899804 | no |
| DIF_cap_tissue | YFB_veil | 0.847048 | no |
| Orthofinder run ID | 1 |
| Orthogroup | 1481 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|109430 MGFTMMKLLIFLSSVITVALATVQGIDVSHFQGSINWSSVRSSGVRWAYIKATEGTTFRDPNFSANYVGATNAGV IRGAYHFAHPDSSSGAAQANFFVDHGGGWSADGITLPGALDIEYAPSGNICYGLSASAMVAWIRDFSNTYHARTG RFPAIYTTTDWWTSCTGNASGFQNNNPLWIARYSSAIGALPAGYTVASFWQYADSGPFPGDQDRWNGDLAGLQRM ARGS* |
| Coding | >AgabiH97|109430 ATGGGGTTCACCATGATGAAACTGTTGATTTTCCTATCTTCTGTTATAACTGTTGCTCTCGCTACAGTCCAGGGC ATTGACGTTTCCCATTTCCAAGGATCCATCAACTGGAGTAGCGTTAGGTCCAGTGGTGTCCGATGGGCATACATA AAGGCCACTGAAGGCACCACTTTCAGGGATCCCAACTTCAGTGCAAACTACGTTGGTGCCACTAATGCTGGCGTC ATTCGTGGCGCCTATCATTTCGCTCATCCCGACTCTTCTTCCGGTGCCGCCCAAGCCAACTTCTTCGTTGACCAT GGAGGAGGCTGGTCCGCTGATGGTATCACTCTCCCTGGTGCCCTGGACATTGAGTATGCACCCTCTGGAAATATA TGCTATGGATTGAGTGCTTCCGCCATGGTTGCTTGGATCCGAGATTTCTCCAACACCTATCATGCAAGGACAGGC CGTTTCCCTGCCATTTACACTACCACAGACTGGTGGACAAGTTGCACCGGAAACGCCAGCGGCTTCCAAAATAAT AATCCCCTTTGGATTGCTCGCTATTCTTCAGCGATTGGTGCACTTCCTGCTGGTTATACAGTTGCTTCCTTCTGG CAGTACGCCGATTCTGGTCCTTTCCCTGGTGACCAAGACAGATGGAATGGCGACCTTGCTGGGCTTCAAAGAATG GCTCGTGGCTCATAA |
| Transcript | >AgabiH97|109430 ATGGGGTTCACCATGATGAAACTGTTGATTTTCCTATCTTCTGTTATAACTGTTGCTCTCGCTACAGTCCAGGGC ATTGACGTTTCCCATTTCCAAGGATCCATCAACTGGAGTAGCGTTAGGTCCAGTGGTGTCCGATGGGCATACATA AAGGCCACTGAAGGCACCACTTTCAGGGATCCCAACTTCAGTGCAAACTACGTTGGTGCCACTAATGCTGGCGTC ATTCGTGGCGCCTATCATTTCGCTCATCCCGACTCTTCTTCCGGTGCCGCCCAAGCCAACTTCTTCGTTGACCAT GGAGGAGGCTGGTCCGCTGATGGTATCACTCTCCCTGGTGCCCTGGACATTGAGTATGCACCCTCTGGAAATATA TGCTATGGATTGAGTGCTTCCGCCATGGTTGCTTGGATCCGAGATTTCTCCAACACCTATCATGCAAGGACAGGC CGTTTCCCTGCCATTTACACTACCACAGACTGGTGGACAAGTTGCACCGGAAACGCCAGCGGCTTCCAAAATAAT AATCCCCTTTGGATTGCTCGCTATTCTTCAGCGATTGGTGCACTTCCTGCTGGTTATACAGTTGCTTCCTTCTGG CAGTACGCCGATTCTGGTCCTTTCCCTGGTGACCAAGACAGATGGAATGGCGACCTTGCTGGGCTTCAAAGAATG GCTCGTGGCTCATAA |
| Gene | >AgabiH97|109430 ATGGGGTTCACCATGATGAAACTGTTGATTTTCCTATCTTCTGTTATAACTGTTGCTCTCGCTACAGTCCAGGGC ATTGACGTTTCCCATTTCCAAGGATCCATCAACTGGAGTAGCGTTAGGTCCAGTGGTGTCCGATGGGCATACATA AAGGCCACTGAAGGCACCAGTACGTTTCACCGGCCCATCGTTTTTCTTAGACTCTCGAGACTGATCACTATCTGC CAGCTTTCAGGGATCCCAACTTCAGTGCAAACTACGTTGGTGCCACTAATGCTGGCGTCATTCGTGGCGCCTATC ATTTCGCTCATCCCGACTCTTCTTCCGGTGCCGCCCAAGCCAACTTCTTCGTTGACCATGGAGGAGGCTGGTCCG CTGATGGTATCACTCTCCCTGGTGCCCTGGACATTGAGTGTACGTATTTGGTTAATTCTACCAGCTTTCGCGCGA GATTTATTGATAACCGAAATACTAATAGATGCACCCTCTGGAAATATATGCTATGGATTGAGTGCTTCCGCCATG GTTGCTTGGATCCGAGATTTCTCCAACACCTATCATGCAAGGACAGGCCGTTTCCCTGCCATTTACACTACCACA GACTGGTGGACAAGTTGCACCGGAAACGCCAGCGGCTTCCAAAATAATAATCCCCTTTGGATTGCTCGCTATTCT TCAGCGATTGGTGCACTTCCTGCTGGTTATACGTAAGTATATTATATTGCCCTATTATAATATGATATTAATGTA ATCTTTGATGTTCCAGAGTTGCTTCCTTCTGGCAGTACGCCGATTCTGGTCCTTTCCCTGGTGACCAAGACAGAT GGAATGGCGACCTTGCTGGGCTTCAAAGGTGAGTTAAAAAGGATTCTTAATTTCAGAAGACTGATAAGTTCTCTA GAATGGCTCGTGGCTCATAA |