Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|109430
Gene name
Locationscaffold_8:808885..809805
Strand+
Gene length (bp)920
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25 1.5E-53 26 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25310|LYSM1_STRGL Lysozyme M1 OS=Streptomyces globisporus GN=acm PE=1 SV=1 23 226 5.0E-72
sp|P00721|LYS_CHASP N,O-diacetylmuramidase OS=Chalaropsis sp. PE=1 SV=1 22 228 2.0E-70
sp|D4ANU4|LYS_ARTBC N,O-diacetylmuramidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05911 PE=1 SV=1 16 228 2.0E-69
sp|Q8FFY2|YEGX_ECOL6 Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yegX PE=3 SV=2 22 223 2.0E-21
sp|P26836|LYS_CLOPE Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) GN=lyc PE=3 SV=2 23 210 6.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25310|LYSM1_STRGL Lysozyme M1 OS=Streptomyces globisporus GN=acm PE=1 SV=1 23 226 5.0E-72
sp|P00721|LYS_CHASP N,O-diacetylmuramidase OS=Chalaropsis sp. PE=1 SV=1 22 228 2.0E-70
sp|D4ANU4|LYS_ARTBC N,O-diacetylmuramidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05911 PE=1 SV=1 16 228 2.0E-69
sp|Q8FFY2|YEGX_ECOL6 Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yegX PE=3 SV=2 22 223 2.0E-21
sp|P26836|LYS_CLOPE Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) GN=lyc PE=3 SV=2 23 210 6.0E-21
sp|P76421|YEGX_ECOLI Uncharacterized protein YegX OS=Escherichia coli (strain K12) GN=yegX PE=3 SV=2 22 228 2.0E-20
sp|Q8X7H0|YEGX_ECO57 Uncharacterized protein YegX OS=Escherichia coli O157:H7 GN=yegX PE=3 SV=2 22 228 2.0E-19
sp|P34020|LYS_CLOAB Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lyc PE=1 SV=1 23 210 2.0E-18
sp|Q86KC1|LYSG2_DICDI Probable GH family 25 lysozyme 2 OS=Dictyostelium discoideum GN=DDB_G0274181 PE=3 SV=1 5 206 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016998 cell wall macromolecule catabolic process Yes
GO:0009253 peptidoglycan catabolic process Yes
GO:0003796 lysozyme activity Yes
GO:1901575 organic substance catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0030203 glycosaminoglycan metabolic process No
GO:0008152 metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044248 cellular catabolic process No
GO:0061783 peptidoglycan muralytic activity No
GO:0006026 aminoglycan catabolic process No
GO:0016787 hydrolase activity No
GO:0006022 aminoglycan metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0006807 nitrogen compound metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0000270 peptidoglycan metabolic process No
GO:0003674 molecular_function No
GO:0044036 cell wall macromolecule metabolic process No
GO:1901136 carbohydrate derivative catabolic process No
GO:0009987 cellular process No
GO:0006027 glycosaminoglycan catabolic process No
GO:0003824 catalytic activity No
GO:0044265 cellular macromolecule catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044237 cellular metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 53.00 22.75 83.24
Initials Initials knots 25.52 12.66 38.38
Pileal_Stipeal_center Stage I stipe center 17.01 7.52 26.50
Pileal_Stipeal_shell Stage I stipe shell 17.63 8.22 27.04
DIF_stipe_center Stage II stipe center 15.24 7.00 23.48
DIF_stipe_shell Stage II stipe shell 13.79 6.25 21.33
DIF_stipe_skin Stage II stipe skin 14.19 6.46 21.91
DIF_cap_skin Stage II cap skin 12.87 5.79 19.95
DIF_cap_tissue Stage II cap tissue 14.11 6.43 21.79
DIF_gill_tissue Stage II gill tissue 16.97 7.91 26.02
YFB_stipe_center Young fruiting body stipe center 15.77 7.26 24.28
YFB_stipe_shell Young fruiting body stipe shell 14.95 6.81 23.09
YFB_stipe_skin Young fruiting body stipe skin 12.31 5.46 19.16
YFB_cap_skin Young fruiting body cap skin 10.29 4.46 16.11
YFB_cap_tissue Young fruiting body cap tissue 15.39 7.11 23.67
YFB_gill_tissue Young fruiting body gill tissue 12.93 5.80 20.06
YFB_veil Young fruiting body veil 12.45 5.57 19.33

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.039612 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.001140 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.914807 no
DIF_gill_tissue YFB_stipe_shell 0.839352 no
DIF_gill_tissue YFB_stipe_skin 0.485354 no
DIF_gill_tissue YFB_cap_skin 0.221143 no
DIF_gill_tissue YFB_cap_tissue 0.882578 no
DIF_gill_tissue YFB_gill_tissue 0.573368 no
DIF_gill_tissue YFB_veil 0.504690 no
YFB_stipe_center YFB_stipe_shell 0.942655 no
YFB_stipe_center YFB_stipe_skin 0.640217 no
YFB_stipe_center YFB_cap_skin 0.341853 no
YFB_stipe_center YFB_cap_tissue 0.974007 no
YFB_stipe_center YFB_gill_tissue 0.726665 no
YFB_stipe_center YFB_veil 0.661161 no
YFB_stipe_shell YFB_stipe_skin 0.732888 no
YFB_stipe_shell YFB_cap_skin 0.422068 no
YFB_stipe_shell YFB_cap_tissue 0.968938 no
YFB_stipe_shell YFB_gill_tissue 0.815431 no
YFB_stipe_shell YFB_veil 0.753266 no
YFB_stipe_skin YFB_cap_skin 0.764358 no
YFB_stipe_skin YFB_cap_tissue 0.680139 no
YFB_stipe_skin YFB_gill_tissue 0.946209 no
YFB_stipe_skin YFB_veil 0.987947 no
YFB_cap_skin YFB_cap_tissue 0.364099 no
YFB_cap_skin YFB_gill_tissue 0.678313 no
YFB_cap_skin YFB_veil 0.745087 no
YFB_cap_tissue YFB_gill_tissue 0.766457 no
YFB_cap_tissue YFB_veil 0.698817 no
YFB_gill_tissue YFB_veil 0.957888 no
Initials DIF_gill_tissue 0.309271 no
Initials YFB_stipe_center 0.217100 no
Initials YFB_stipe_shell 0.153146 no
Initials YFB_stipe_skin 0.037364 yes
Initials YFB_cap_skin 0.009446 yes
Initials YFB_cap_tissue 0.186312 no
Initials YFB_gill_tissue 0.055381 no
Initials YFB_veil 0.039390 yes
Initials Pileal_Stipeal_center 0.321898 no
Initials Pileal_Stipeal_shell 0.366791 no
Initials DIF_stipe_center 0.178332 no
Initials DIF_stipe_shell 0.089641 no
Initials DIF_stipe_skin 0.107930 no
Initials DIF_cap_skin 0.046952 yes
Initials DIF_cap_tissue 0.111181 no
Pileal_Stipeal_center DIF_gill_tissue 0.996319 no
Pileal_Stipeal_center YFB_stipe_center 0.913716 no
Pileal_Stipeal_center YFB_stipe_shell 0.839569 no
Pileal_Stipeal_center YFB_stipe_skin 0.492381 no
Pileal_Stipeal_center YFB_cap_skin 0.228362 no
Pileal_Stipeal_center YFB_cap_tissue 0.883295 no
Pileal_Stipeal_center YFB_gill_tissue 0.576983 no
Pileal_Stipeal_center YFB_veil 0.511613 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.959464 no
Pileal_Stipeal_center DIF_stipe_center 0.867919 no
Pileal_Stipeal_center DIF_stipe_shell 0.698000 no
Pileal_Stipeal_center DIF_stipe_skin 0.753040 no
Pileal_Stipeal_center DIF_cap_skin 0.566262 no
Pileal_Stipeal_center DIF_cap_tissue 0.744147 no
Pileal_Stipeal_shell DIF_gill_tissue 0.956140 no
Pileal_Stipeal_shell YFB_stipe_center 0.859524 no
Pileal_Stipeal_shell YFB_stipe_shell 0.772524 no
Pileal_Stipeal_shell YFB_stipe_skin 0.412221 no
Pileal_Stipeal_shell YFB_cap_skin 0.174105 no
Pileal_Stipeal_shell YFB_cap_tissue 0.823412 no
Pileal_Stipeal_shell YFB_gill_tissue 0.498178 no
Pileal_Stipeal_shell YFB_veil 0.433516 no
Pileal_Stipeal_shell DIF_stipe_center 0.807003 no
Pileal_Stipeal_shell DIF_stipe_shell 0.621523 no
Pileal_Stipeal_shell DIF_stipe_skin 0.678191 no
Pileal_Stipeal_shell DIF_cap_skin 0.490031 no
Pileal_Stipeal_shell DIF_cap_tissue 0.672031 no
DIF_stipe_center DIF_gill_tissue 0.868156 no
DIF_stipe_center YFB_stipe_center 0.962748 no
DIF_stipe_center YFB_stipe_shell 0.979508 no
DIF_stipe_center YFB_stipe_skin 0.694804 no
DIF_stipe_center YFB_cap_skin 0.389457 no
DIF_stipe_center YFB_cap_tissue 0.988804 no
DIF_stipe_center YFB_gill_tissue 0.781116 no
DIF_stipe_center YFB_veil 0.714849 no
DIF_stipe_center DIF_stipe_shell 0.880633 no
DIF_stipe_center DIF_stipe_skin 0.919218 no
DIF_stipe_center DIF_cap_skin 0.774188 no
DIF_stipe_center DIF_cap_tissue 0.912615 no
DIF_stipe_shell DIF_gill_tissue 0.702338 no
DIF_stipe_shell YFB_stipe_center 0.832100 no
DIF_stipe_shell YFB_stipe_shell 0.906722 no
DIF_stipe_shell YFB_stipe_skin 0.862994 no
DIF_stipe_shell YFB_cap_skin 0.567612 no
DIF_stipe_shell YFB_cap_tissue 0.870176 no
DIF_stipe_shell YFB_gill_tissue 0.928804 no
DIF_stipe_shell YFB_veil 0.878518 no
DIF_stipe_shell DIF_stipe_skin 0.969893 no
DIF_stipe_shell DIF_cap_skin 0.923027 no
DIF_stipe_shell DIF_cap_tissue 0.975361 no
DIF_stipe_skin DIF_gill_tissue 0.753818 no
DIF_stipe_skin YFB_stipe_center 0.875284 no
DIF_stipe_skin YFB_stipe_shell 0.943631 no
DIF_stipe_skin YFB_stipe_skin 0.821698 no
DIF_stipe_skin YFB_cap_skin 0.517429 no
DIF_stipe_skin YFB_cap_tissue 0.909230 no
DIF_stipe_skin YFB_gill_tissue 0.892813 no
DIF_stipe_skin YFB_veil 0.839876 no
DIF_stipe_skin DIF_cap_skin 0.887570 no
DIF_stipe_skin DIF_cap_tissue 0.994203 no
DIF_cap_skin DIF_gill_tissue 0.575547 no
DIF_cap_skin YFB_stipe_center 0.721293 no
DIF_cap_skin YFB_stipe_shell 0.807384 no
DIF_cap_skin YFB_stipe_skin 0.952184 no
DIF_cap_skin YFB_cap_skin 0.693243 no
DIF_cap_skin YFB_cap_tissue 0.762646 no
DIF_cap_skin YFB_gill_tissue 0.994225 no
DIF_cap_skin YFB_veil 0.963352 no
DIF_cap_skin DIF_cap_tissue 0.893840 no
DIF_cap_tissue DIF_gill_tissue 0.741726 no
DIF_cap_tissue YFB_stipe_center 0.866847 no
DIF_cap_tissue YFB_stipe_shell 0.935884 no
DIF_cap_tissue YFB_stipe_skin 0.829027 no
DIF_cap_tissue YFB_cap_skin 0.525365 no
DIF_cap_tissue YFB_cap_tissue 0.902563 no
DIF_cap_tissue YFB_gill_tissue 0.899804 no
DIF_cap_tissue YFB_veil 0.847048 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|109430
MGFTMMKLLIFLSSVITVALATVQGIDVSHFQGSINWSSVRSSGVRWAYIKATEGTTFRDPNFSANYVGATNAGV
IRGAYHFAHPDSSSGAAQANFFVDHGGGWSADGITLPGALDIEYAPSGNICYGLSASAMVAWIRDFSNTYHARTG
RFPAIYTTTDWWTSCTGNASGFQNNNPLWIARYSSAIGALPAGYTVASFWQYADSGPFPGDQDRWNGDLAGLQRM
ARGS*
Coding >AgabiH97|109430
ATGGGGTTCACCATGATGAAACTGTTGATTTTCCTATCTTCTGTTATAACTGTTGCTCTCGCTACAGTCCAGGGC
ATTGACGTTTCCCATTTCCAAGGATCCATCAACTGGAGTAGCGTTAGGTCCAGTGGTGTCCGATGGGCATACATA
AAGGCCACTGAAGGCACCACTTTCAGGGATCCCAACTTCAGTGCAAACTACGTTGGTGCCACTAATGCTGGCGTC
ATTCGTGGCGCCTATCATTTCGCTCATCCCGACTCTTCTTCCGGTGCCGCCCAAGCCAACTTCTTCGTTGACCAT
GGAGGAGGCTGGTCCGCTGATGGTATCACTCTCCCTGGTGCCCTGGACATTGAGTATGCACCCTCTGGAAATATA
TGCTATGGATTGAGTGCTTCCGCCATGGTTGCTTGGATCCGAGATTTCTCCAACACCTATCATGCAAGGACAGGC
CGTTTCCCTGCCATTTACACTACCACAGACTGGTGGACAAGTTGCACCGGAAACGCCAGCGGCTTCCAAAATAAT
AATCCCCTTTGGATTGCTCGCTATTCTTCAGCGATTGGTGCACTTCCTGCTGGTTATACAGTTGCTTCCTTCTGG
CAGTACGCCGATTCTGGTCCTTTCCCTGGTGACCAAGACAGATGGAATGGCGACCTTGCTGGGCTTCAAAGAATG
GCTCGTGGCTCATAA
Transcript >AgabiH97|109430
ATGGGGTTCACCATGATGAAACTGTTGATTTTCCTATCTTCTGTTATAACTGTTGCTCTCGCTACAGTCCAGGGC
ATTGACGTTTCCCATTTCCAAGGATCCATCAACTGGAGTAGCGTTAGGTCCAGTGGTGTCCGATGGGCATACATA
AAGGCCACTGAAGGCACCACTTTCAGGGATCCCAACTTCAGTGCAAACTACGTTGGTGCCACTAATGCTGGCGTC
ATTCGTGGCGCCTATCATTTCGCTCATCCCGACTCTTCTTCCGGTGCCGCCCAAGCCAACTTCTTCGTTGACCAT
GGAGGAGGCTGGTCCGCTGATGGTATCACTCTCCCTGGTGCCCTGGACATTGAGTATGCACCCTCTGGAAATATA
TGCTATGGATTGAGTGCTTCCGCCATGGTTGCTTGGATCCGAGATTTCTCCAACACCTATCATGCAAGGACAGGC
CGTTTCCCTGCCATTTACACTACCACAGACTGGTGGACAAGTTGCACCGGAAACGCCAGCGGCTTCCAAAATAAT
AATCCCCTTTGGATTGCTCGCTATTCTTCAGCGATTGGTGCACTTCCTGCTGGTTATACAGTTGCTTCCTTCTGG
CAGTACGCCGATTCTGGTCCTTTCCCTGGTGACCAAGACAGATGGAATGGCGACCTTGCTGGGCTTCAAAGAATG
GCTCGTGGCTCATAA
Gene >AgabiH97|109430
ATGGGGTTCACCATGATGAAACTGTTGATTTTCCTATCTTCTGTTATAACTGTTGCTCTCGCTACAGTCCAGGGC
ATTGACGTTTCCCATTTCCAAGGATCCATCAACTGGAGTAGCGTTAGGTCCAGTGGTGTCCGATGGGCATACATA
AAGGCCACTGAAGGCACCAGTACGTTTCACCGGCCCATCGTTTTTCTTAGACTCTCGAGACTGATCACTATCTGC
CAGCTTTCAGGGATCCCAACTTCAGTGCAAACTACGTTGGTGCCACTAATGCTGGCGTCATTCGTGGCGCCTATC
ATTTCGCTCATCCCGACTCTTCTTCCGGTGCCGCCCAAGCCAACTTCTTCGTTGACCATGGAGGAGGCTGGTCCG
CTGATGGTATCACTCTCCCTGGTGCCCTGGACATTGAGTGTACGTATTTGGTTAATTCTACCAGCTTTCGCGCGA
GATTTATTGATAACCGAAATACTAATAGATGCACCCTCTGGAAATATATGCTATGGATTGAGTGCTTCCGCCATG
GTTGCTTGGATCCGAGATTTCTCCAACACCTATCATGCAAGGACAGGCCGTTTCCCTGCCATTTACACTACCACA
GACTGGTGGACAAGTTGCACCGGAAACGCCAGCGGCTTCCAAAATAATAATCCCCTTTGGATTGCTCGCTATTCT
TCAGCGATTGGTGCACTTCCTGCTGGTTATACGTAAGTATATTATATTGCCCTATTATAATATGATATTAATGTA
ATCTTTGATGTTCCAGAGTTGCTTCCTTCTGGCAGTACGCCGATTCTGGTCCTTTCCCTGGTGACCAAGACAGAT
GGAATGGCGACCTTGCTGGGCTTCAAAGGTGAGTTAAAAAGGATTCTTAATTTCAGAAGACTGATAAGTTCTCTA
GAATGGCTCGTGGCTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail