Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|109340
Gene name
Locationscaffold_8:787560..789779
Strand-
Gene length (bp)2219
Transcript length (bp)1743
Coding sequence length (bp)1743
Protein length (aa) 581

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01591 6PF2K 6-phosphofructo-2-kinase 3.1E-61 14 226
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 1.5E-17 396 507

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 5 303 2.0E-52
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 14 300 1.0E-49
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 14 300 2.0E-48
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 20 300 3.0E-48
sp|Q9JJH5|F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus GN=Pfkfb2 PE=1 SV=1 20 300 1.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 5 303 2.0E-52
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 14 300 1.0E-49
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 14 300 2.0E-48
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 20 300 3.0E-48
sp|Q9JJH5|F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus GN=Pfkfb2 PE=1 SV=1 20 300 1.0E-47
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 18 300 1.0E-47
sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2 20 300 7.0E-47
sp|Q5NVT1|F262_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Pongo abelii GN=PFKFB2 PE=2 SV=1 20 300 1.0E-46
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 5 322 3.0E-46
sp|P26285|F262_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Bos taurus GN=PFKFB2 PE=1 SV=2 20 300 3.0E-46
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 5 322 4.0E-46
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 20 301 1.0E-45
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 5 300 1.0E-45
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 5 300 2.0E-45
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 20 301 2.0E-45
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 14 300 2.0E-45
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 20 301 2.0E-45
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 14 300 7.0E-45
sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=1 SV=2 14 300 2.0E-44
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 20 300 6.0E-44
sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 19 307 9.0E-44
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 20 300 2.0E-43
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 14 300 4.0E-43
sp|Q9UTK9|YIVH_SCHPO Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase C144.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.17c PE=1 SV=2 6 224 5.0E-39
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 18 303 5.0E-37
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 18 277 3.0E-36
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 16 303 7.0E-35
sp|Q9URZ7|YK72_SCHPO Probable fructose-2,6-bisphosphatase C732.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC732.02c PE=3 SV=1 19 300 9.0E-30
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 396 504 4.0E-24
sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 406 520 4.0E-21
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 406 511 6.0E-20
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 406 518 1.0E-19
sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=1 SV=2 406 518 1.0E-19
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 406 518 1.0E-19
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 406 518 2.0E-19
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 406 518 2.0E-19
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 406 518 2.0E-19
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 406 518 2.0E-19
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 406 518 3.0E-19
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 406 511 6.0E-19
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 406 511 9.0E-19
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 406 511 9.0E-19
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 347 516 3.0E-18
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 406 518 5.0E-18
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 406 511 8.0E-18
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 406 511 8.0E-18
sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2 406 511 5.0E-17
sp|Q5NVT1|F262_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Pongo abelii GN=PFKFB2 PE=2 SV=1 406 511 7.0E-17
sp|Q9UTK9|YIVH_SCHPO Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase C144.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.17c PE=1 SV=2 409 511 8.0E-17
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 406 511 1.0E-16
sp|Q9JJH5|F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus GN=Pfkfb2 PE=1 SV=1 406 511 2.0E-16
sp|P26285|F262_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Bos taurus GN=PFKFB2 PE=1 SV=2 406 511 4.0E-16
sp|Q9URZ7|YK72_SCHPO Probable fructose-2,6-bisphosphatase C732.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC732.02c PE=3 SV=1 406 509 3.0E-14
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 399 511 8.0E-13
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 399 511 2.0E-12
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 394 518 9.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003873 6-phosphofructo-2-kinase activity Yes
GO:0005524 ATP binding Yes
GO:0006000 fructose metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044281 small molecule metabolic process No
GO:0016301 kinase activity No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008443 phosphofructokinase activity No
GO:0043167 ion binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0019318 hexose metabolic process No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0005996 monosaccharide metabolic process No
GO:0016740 transferase activity No
GO:0005975 carbohydrate metabolic process No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No
GO:0019200 carbohydrate kinase activity No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|109340
MVAPLYVTASGLLFHAGKILVLTVGLPARGKTHISRALERYLRWTGVKTQVISMGDYRRKTLGGAQKLPPDYFSY
GARSPETEQLRKSVANGCEQLIWEFFDSGGQVVIYDANNGTRAAREAMAEKFENKGIHIIFLESCCDKQEVIERN
IRSVKISSPDYKGWDPDKAVEDYYGRIKDRERLYEPVEELTWPYIRIFNVGEKILLNKIQGYLQSRIVFFLMNIH
NRFRTIWFARSGQSLIEHSYKADSDLSPAGWEYAEKLKDTVLSRRMKVLQERGIDPAQRKLVIWTSTRRRAHHTA
WPFVSSPLSEDFDVADNQPLEIFPDAKPDTPRRKLNPNQTLKLPIHGVVARDAPVNTPRLKPISDALADGLVLGG
SSGSSTPLLSAKQPKVVVPEIKVVEKTQMLEINPGIWDGLTPDQAKKYYPEDWERFTKDPYSYRVPRAESYHDLS
VRLEPILIELERESEDLLIIGHASVIRCLLAYLVGLPAAEIPAIEIARGDLLEIVPASYGVHSRAFHFWDGPGRT
GEGGAGADGLTLGKDQNNFYENYAEDTKGKRITFTDGDVFGNAFADQLHSMRRDL*
Coding >AgabiH97|109340
ATGGTCGCCCCATTATATGTTACAGCATCCGGGTTACTCTTTCATGCTGGAAAAATCCTAGTTCTTACCGTCGGT
CTACCTGCCCGAGGCAAAACGCACATTTCACGAGCATTAGAACGATACCTACGATGGACGGGCGTCAAGACTCAA
GTGATCAGTATGGGCGATTATCGGCGCAAGACTTTAGGCGGTGCTCAGAAGTTACCCCCAGATTATTTCTCTTAT
GGTGCGAGGTCGCCTGAGACGGAGCAATTGAGGAAGAGTGTGGCGAATGGATGTGAACAGTTGATTTGGGAGTTT
TTTGATTCTGGGGGCCAGGTAGTGATTTATGATGCTAATAATGGGACGAGGGCGGCTAGAGAAGCTATGGCGGAG
AAGTTTGAGAACAAGGGGATTCATATCATTTTCCTTGAGTCCTGCTGTGATAAGCAAGAGGTAATAGAAAGGAAT
ATTCGAAGTGTCAAGATCTCTTCTCCGGATTACAAGGGATGGGATCCAGATAAAGCTGTTGAAGATTATTATGGT
CGTATTAAGGATCGTGAAAGGCTCTATGAACCGGTTGAAGAGCTCACTTGGCCATATATCCGCATATTCAACGTC
GGCGAGAAGATACTGTTAAACAAAATTCAAGGATATCTCCAATCCCGAATCGTGTTCTTCTTGATGAACATCCAC
AACCGGTTTCGTACCATTTGGTTTGCTCGTTCAGGTCAATCATTGATCGAACACTCGTATAAAGCCGATTCGGAT
CTCTCGCCTGCTGGTTGGGAATATGCTGAGAAACTCAAGGATACTGTCCTCTCGCGTAGGATGAAGGTGTTACAA
GAACGTGGTATAGACCCGGCTCAACGTAAACTCGTCATTTGGACTTCAACTCGCCGAAGGGCACATCATACTGCT
TGGCCGTTCGTTTCAAGTCCTCTATCGGAAGATTTCGACGTAGCAGATAATCAGCCCTTAGAAATCTTCCCAGAT
GCAAAGCCCGATACTCCTCGGCGCAAACTGAACCCAAACCAAACGCTTAAATTACCAATCCATGGCGTCGTGGCG
AGGGATGCGCCAGTCAATACACCACGACTCAAACCTATTTCTGATGCTCTCGCTGATGGGCTCGTTTTAGGAGGG
TCTAGTGGTTCTTCCACGCCTCTTCTTTCGGCCAAACAACCCAAGGTGGTTGTTCCTGAAATCAAGGTTGTGGAG
AAGACGCAGATGTTGGAGATTAATCCTGGGATCTGGGATGGTTTGACTCCGGATCAAGCGAAGAAGTATTATCCT
GAAGATTGGGAAAGGTTTACGAAGGATCCATATTCGTATCGTGTGCCACGAGCAGAGAGTTATCACGATCTAAGT
GTTCGATTAGAACCCATTCTCATTGAACTCGAACGTGAAAGTGAAGATCTTCTCATTATAGGTCATGCGTCCGTC
ATTCGTTGTCTTCTCGCGTACCTCGTAGGTCTCCCAGCAGCAGAAATACCAGCAATCGAGATTGCTCGTGGTGAT
TTATTGGAAATAGTTCCTGCATCGTATGGGGTTCATAGCAGAGCTTTTCATTTTTGGGATGGACCGGGGAGGACT
GGGGAGGGTGGTGCTGGTGCTGACGGGTTGACTTTGGGTAAGGATCAGAATAATTTTTATGAGAATTATGCGGAG
GATACGAAAGGGAAGAGGATTACGTTTACGGATGGAGATGTTTTTGGGAATGCGTTTGCTGACCAGTTGCATAGT
ATGAGGCGGGATTTATAG
Transcript >AgabiH97|109340
ATGGTCGCCCCATTATATGTTACAGCATCCGGGTTACTCTTTCATGCTGGAAAAATCCTAGTTCTTACCGTCGGT
CTACCTGCCCGAGGCAAAACGCACATTTCACGAGCATTAGAACGATACCTACGATGGACGGGCGTCAAGACTCAA
GTGATCAGTATGGGCGATTATCGGCGCAAGACTTTAGGCGGTGCTCAGAAGTTACCCCCAGATTATTTCTCTTAT
GGTGCGAGGTCGCCTGAGACGGAGCAATTGAGGAAGAGTGTGGCGAATGGATGTGAACAGTTGATTTGGGAGTTT
TTTGATTCTGGGGGCCAGGTAGTGATTTATGATGCTAATAATGGGACGAGGGCGGCTAGAGAAGCTATGGCGGAG
AAGTTTGAGAACAAGGGGATTCATATCATTTTCCTTGAGTCCTGCTGTGATAAGCAAGAGGTAATAGAAAGGAAT
ATTCGAAGTGTCAAGATCTCTTCTCCGGATTACAAGGGATGGGATCCAGATAAAGCTGTTGAAGATTATTATGGT
CGTATTAAGGATCGTGAAAGGCTCTATGAACCGGTTGAAGAGCTCACTTGGCCATATATCCGCATATTCAACGTC
GGCGAGAAGATACTGTTAAACAAAATTCAAGGATATCTCCAATCCCGAATCGTGTTCTTCTTGATGAACATCCAC
AACCGGTTTCGTACCATTTGGTTTGCTCGTTCAGGTCAATCATTGATCGAACACTCGTATAAAGCCGATTCGGAT
CTCTCGCCTGCTGGTTGGGAATATGCTGAGAAACTCAAGGATACTGTCCTCTCGCGTAGGATGAAGGTGTTACAA
GAACGTGGTATAGACCCGGCTCAACGTAAACTCGTCATTTGGACTTCAACTCGCCGAAGGGCACATCATACTGCT
TGGCCGTTCGTTTCAAGTCCTCTATCGGAAGATTTCGACGTAGCAGATAATCAGCCCTTAGAAATCTTCCCAGAT
GCAAAGCCCGATACTCCTCGGCGCAAACTGAACCCAAACCAAACGCTTAAATTACCAATCCATGGCGTCGTGGCG
AGGGATGCGCCAGTCAATACACCACGACTCAAACCTATTTCTGATGCTCTCGCTGATGGGCTCGTTTTAGGAGGG
TCTAGTGGTTCTTCCACGCCTCTTCTTTCGGCCAAACAACCCAAGGTGGTTGTTCCTGAAATCAAGGTTGTGGAG
AAGACGCAGATGTTGGAGATTAATCCTGGGATCTGGGATGGTTTGACTCCGGATCAAGCGAAGAAGTATTATCCT
GAAGATTGGGAAAGGTTTACGAAGGATCCATATTCGTATCGTGTGCCACGAGCAGAGAGTTATCACGATCTAAGT
GTTCGATTAGAACCCATTCTCATTGAACTCGAACGTGAAAGTGAAGATCTTCTCATTATAGGTCATGCGTCCGTC
ATTCGTTGTCTTCTCGCGTACCTCGTAGGTCTCCCAGCAGCAGAAATACCAGCAATCGAGATTGCTCGTGGTGAT
TTATTGGAAATAGTTCCTGCATCGTATGGGGTTCATAGCAGAGCTTTTCATTTTTGGGATGGACCGGGGAGGACT
GGGGAGGGTGGTGCTGGTGCTGACGGGTTGACTTTGGGTAAGGATCAGAATAATTTTTATGAGAATTATGCGGAG
GATACGAAAGGGAAGAGGATTACGTTTACGGATGGAGATGTTTTTGGGAATGCGTTTGCTGACCAGTTGCATAGT
ATGAGGCGGGATTTATAG
Gene >AgabiH97|109340
ATGGTCGCCCCATTATATGTTACAGCATCCGGGTTACTCTTTCATGCTGGAAAAATCCTAGTTCTTACCGTCGGT
CTACCTGCCCGAGGCAAAACGCACATTTCACGAGCATTAGAACGATACCTACGATGGACGGGCGTCAAGACTCAA
GTGATCAGTATGGGCGATTATCGGCGCAAGACTTTAGGCGGTGCTCAGAAGTTACCCCCAGATTATTTCTCTTAT
GGTACGTGTTTGGATCATATCTTGAGATGTTGAGATGTTGATAGAGTATTGTTATATCAGGTGCGAGGTCGCCTG
AGACGGAGCAATTGAGGAAGAGTGTGGCGAATGGATGTGAACAGTTGATTTGGGAGTTTTTTGATTCTGGGGGCC
AGGTAGTGATTTATGATGCTAATAATGGGACGAGGGCGGCTAGAGAAGCTATGGCGGAGAAGTTTGAGAACAAGG
GGATTCATATCATTTTCCTTGGTTCGTCTTTTCTCAATTCTTGATCGTATATAGGTCGATTAAGCATTCTTTAGA
GTCCTGCTGTGATAAGCAAGAGGTAATAGAAAGGAATATTCGAAGTGTCAAGATCTCTTCTCCGGATGTAAGTGT
TCTTCAAGATCTATGACTTTCCTCTCTGCTAATGTCATTCACTGTATTTTCTAGTACAAGGGATGGGATCCAGAT
AAAGCTGTTGAAGATTATTATGGTCGTATTAAGGATCGTGAAAGGCTCTATGAACCGGTTGAAGAGCTCACTTGG
CCATATATCCGCATATTCAACGTCGGCGAGAAGATACTGTTAAACGTACGTGATAGGAGACCTTTGCAATCACTG
TTGCGAACTAATGAGATATTCATACTTCAAAGAAAATTCAAGGATATCTCCAAGTACGATTCGTATTCTCGAAAC
GAACTAAAAAAAACAAACACATATATTTATATAGTCCCGAATCGTGTTCTTCTTGATGAACATCCACAACCGGTT
TCGTACCATTTGGTTTGCTCGTGTATGTCTACATCTCCACTTTCATGATCCGTACACCATCTTGACATGTGTCAT
GAATGATTTTCAGTCAGGTCAATCATTGATCGAACACTCGTATAAAGCCGATTCGGATCTCTCGCCTGCTGGTTG
GGAATATGCTGAGAAACTCAAGGATACTGTCCTCTCGCGTAGGATGAAGGTGTTACAAGAACGTGGTATAGACCC
GGCTCAACGTAAACTCGTCGTACGTATCGTGATGGTAGAGAAAATTCGAAGCAGATTATACTGATATATACTCTA
TAGATTTGGACTTCAACTCGCCGAAGGGCACATCATACTGCTTGGCCGTTCGTTTCAAGTCCTCTATCGGAAGAT
TTCGACGTAGCAGATAATCAGCCCTTAGAAATCTTCCCAGATGCAAAGCCCGATACTCCTCGGCGCAAACTGAAC
CCAAACCAAACGCTTAAATTACCAATCCATGGCGTCGTGGCGAGGGATGCGCCAGTCAATACACCACGACTCAAA
CCTATTTCTGATGCTCTCGCTGATGGGCTCGTTTTAGGAGGGTCTAGTGGTTCTTCCACGCCTCTTCTTTCGGCC
AAACAACCCAAGGTGGTTGTTCCTGAAATCAAGGTTGTGGAGAAGACGCAGATGTTGGAGATTAATCCTGGGATC
TGGGATGGTTTGACTCCGGATCAAGCGAAGAAGTATTATCCTGAAGATTGGGAAAGGTTTACGAAGGATCCATAT
TCGTATCGTGTGCCACGAGCAGAGAGTTATCACGATCTAAGTGGTATGTATATATACATGAGCTCCGTTTGCTGG
CCTGGAACGCTGAATTCATGTTTACAGTTCGATTAGAACCCATTCTCATTGAACTCGAACGTGAAAGTGAAGATC
TTCTCATTATAGGTCATGCGTCCGTCATTCGTTGTCTTCTCGCGTACCTCGTAGGTCTCCCAGCAGCAGAAATAC
CAGCAATCGAGATTGCTCGTGGTGATTTATTGGAAATAGTTCCTGCATCGTATGGGGTTCATAGCAGAGCTTTTC
ATTTTTGGGATGGACCGGGGAGGACTGGGGAGGGTGGTGCTGGTGCTGACGGGTTGACTTTGGGTAAGGATCAGA
ATAATTTTTATGAGAATTATGCGGAGGATACGAAAGGGAAGAGGATTACGTTTACGGATGGAGATGTTTTTGGGA
ATGCGTTTGCTGACCAGTTGCATAGTATGAGGCGGGATTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail