© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|109210 |
| Gene name | |
| Location | scaffold_8:749231..751947 |
| Strand | - |
| Gene length (bp) | 2716 |
| Transcript length (bp) | 2274 |
| Coding sequence length (bp) | 2274 |
| Protein length (aa) | 758 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF01380 | SIS | SIS domain | 2.4E-34 | 440 | 566 |
| PF01380 | SIS | SIS domain | 1.1E-26 | 611 | 738 |
| PF13522 | GATase_6 | Glutamine amidotransferase domain | 1.2E-18 | 138 | 254 |
| PF13537 | GATase_7 | Glutamine amidotransferase domain | 1.3E-13 | 153 | 244 |
| PF13230 | GATase_4 | Glutamine amidotransferases class-II | 1.0E-05 | 137 | 243 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P14742|GFA1_YEAST | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GFA1 PE=1 SV=4 | 59 | 757 | 0.0E+00 |
| sp|P53704|GFA1_CANAL | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GFA1 PE=1 SV=2 | 59 | 757 | 0.0E+00 |
| sp|Q09740|GFA1_SCHPO | Probable glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.11 PE=3 SV=2 | 59 | 757 | 0.0E+00 |
| sp|Q4KMC4|GFPT2_RAT | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Rattus norvegicus GN=Gfpt2 PE=1 SV=3 | 59 | 757 | 0.0E+00 |
| sp|Q9Z2Z9|GFPT2_MOUSE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Mus musculus GN=Gfpt2 PE=1 SV=3 | 59 | 757 | 0.0E+00 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P14742|GFA1_YEAST | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GFA1 PE=1 SV=4 | 59 | 757 | 0.0E+00 |
| sp|P53704|GFA1_CANAL | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GFA1 PE=1 SV=2 | 59 | 757 | 0.0E+00 |
| sp|Q09740|GFA1_SCHPO | Probable glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.11 PE=3 SV=2 | 59 | 757 | 0.0E+00 |
| sp|Q4KMC4|GFPT2_RAT | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Rattus norvegicus GN=Gfpt2 PE=1 SV=3 | 59 | 757 | 0.0E+00 |
| sp|Q9Z2Z9|GFPT2_MOUSE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Mus musculus GN=Gfpt2 PE=1 SV=3 | 59 | 757 | 0.0E+00 |
| sp|P82808|GFPT1_RAT | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Rattus norvegicus GN=Gfpt1 PE=1 SV=3 | 59 | 757 | 0.0E+00 |
| sp|O94808|GFPT2_HUMAN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Homo sapiens GN=GFPT2 PE=1 SV=3 | 59 | 757 | 0.0E+00 |
| sp|Q08DQ2|GFPT2_BOVIN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Bos taurus GN=GFPT2 PE=2 SV=1 | 59 | 757 | 0.0E+00 |
| sp|P47856|GFPT1_MOUSE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Mus musculus GN=Gfpt1 PE=1 SV=3 | 59 | 757 | 0.0E+00 |
| sp|Q06210|GFPT1_HUMAN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens GN=GFPT1 PE=1 SV=3 | 59 | 757 | 0.0E+00 |
| sp|Q8SRI2|GFA1_ENCCU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Encephalitozoon cuniculi (strain GB-M1) GN=GFA1 PE=1 SV=1 | 59 | 757 | 0.0E+00 |
| sp|B3LLX6|YM084_YEAS1 | Putative glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SCRG_01975 PE=3 SV=1 | 59 | 753 | 0.0E+00 |
| sp|C7GL41|YM084_YEAS2 | Putative glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain JAY291) GN=C1Q_01026 PE=3 SV=2 | 59 | 753 | 0.0E+00 |
| sp|A6ZME2|YM084_YEAS7 | Putative glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_4254 PE=3 SV=1 | 59 | 753 | 0.0E+00 |
| sp|Q8KG38|GLMS_CHLTE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=glmS PE=3 SV=3 | 59 | 757 | 4.0E-159 |
| sp|P0CF18|YM085_YEAST | Uncharacterized protein YMR085W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR085W PE=5 SV=1 | 325 | 753 | 3.0E-154 |
| sp|C8ZET8|YM085_YEAS8 | Uncharacterized protein EC1118_1M3_2531g OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=EC1118_1M3_2531g PE=5 SV=1 | 325 | 753 | 5.0E-154 |
| sp|Q8AAB1|GLMS_BACTN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=glmS PE=3 SV=2 | 59 | 757 | 2.0E-143 |
| sp|Q6CYJ9|GLMS_PECAS | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glmS PE=3 SV=3 | 59 | 757 | 5.0E-132 |
| sp|O66648|GLMS_AQUAE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Aquifex aeolicus (strain VF5) GN=glmS PE=3 SV=3 | 59 | 757 | 6.0E-130 |
| sp|Q8FBT4|GLMS_ECOL6 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glmS PE=3 SV=3 | 59 | 757 | 2.0E-125 |
| sp|Q83IY4|GLMS_SHIFL | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Shigella flexneri GN=glmS PE=3 SV=3 | 59 | 757 | 3.0E-125 |
| sp|Q8ZKX1|GLMS_SALTY | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glmS PE=3 SV=3 | 59 | 757 | 4.0E-125 |
| sp|P17169|GLMS_ECOLI | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Escherichia coli (strain K12) GN=glmS PE=1 SV=4 | 59 | 757 | 5.0E-125 |
| sp|Q8XEG2|GLMS_ECO57 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Escherichia coli O157:H7 GN=glmS PE=3 SV=3 | 59 | 757 | 6.0E-125 |
| sp|Q5PKV9|GLMS_SALPA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glmS PE=3 SV=3 | 59 | 757 | 7.0E-125 |
| sp|Q8Z2Q2|GLMS_SALTI | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Salmonella typhi GN=glmS PE=3 SV=3 | 59 | 757 | 2.0E-124 |
| sp|Q97MN6|GLMS_CLOAB | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glmS PE=3 SV=3 | 59 | 757 | 5.0E-122 |
| sp|P44708|GLMS_HAEIN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glmS PE=3 SV=2 | 59 | 757 | 4.0E-118 |
| sp|Q73S23|GLMS_MYCPA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=glmS PE=3 SV=3 | 59 | 757 | 2.0E-117 |
| sp|Q7MP62|GLMS_VIBVY | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio vulnificus (strain YJ016) GN=glmS PE=3 SV=3 | 59 | 757 | 1.0E-115 |
| sp|Q8DEF3|GLMS_VIBVU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio vulnificus (strain CMCP6) GN=glmS PE=3 SV=3 | 59 | 757 | 4.0E-115 |
| sp|Q5E279|GLMS_VIBF1 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=glmS PE=3 SV=3 | 59 | 757 | 5.0E-115 |
| sp|Q9JWN9|GLMS_NEIMA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=glmS PE=3 SV=3 | 59 | 757 | 6.0E-115 |
| sp|Q8KA75|GLMS_BUCAP | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=glmS PE=3 SV=3 | 59 | 757 | 7.0E-115 |
| sp|Q87SR3|GLMS_VIBPA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glmS PE=3 SV=2 | 59 | 757 | 2.0E-114 |
| sp|Q9K1P9|GLMS_NEIMB | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Neisseria meningitidis serogroup B (strain MC58) GN=glmS PE=3 SV=3 | 59 | 757 | 7.0E-114 |
| sp|Q9KUM8|GLMS_VIBCH | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glmS PE=3 SV=3 | 59 | 757 | 7.0E-114 |
| sp|Q5NHQ9|GLMS_FRATT | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=glmS PE=1 SV=3 | 59 | 757 | 3.0E-113 |
| sp|Q8FNH2|GLMS_COREF | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=glmS PE=3 SV=3 | 59 | 757 | 4.0E-113 |
| sp|Q6LLH3|GLMS_PHOPR | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Photobacterium profundum GN=glmS PE=3 SV=3 | 59 | 757 | 2.0E-112 |
| sp|Q6FZH6|GLMS_BARQU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bartonella quintana (strain Toulouse) GN=glmS PE=3 SV=3 | 59 | 757 | 4.0E-112 |
| sp|Q5F584|GLMS_NEIG1 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=glmS PE=3 SV=3 | 59 | 757 | 6.0E-112 |
| sp|P40831|GLMS_MYCLE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium leprae (strain TN) GN=glmS PE=3 SV=3 | 59 | 757 | 7.0E-112 |
| sp|Q92ZK3|NODM_RHIME | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium meliloti (strain 1021) GN=nodM PE=3 SV=3 | 59 | 757 | 9.0E-112 |
| sp|Q8Y303|GLMS_RALSO | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Ralstonia solanacearum (strain GMI1000) GN=glmS PE=3 SV=3 | 59 | 757 | 2.0E-111 |
| sp|Q6NG33|GLMS_CORDI | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=glmS PE=3 SV=3 | 59 | 757 | 2.0E-111 |
| sp|Q92PS4|GLMS_RHIME | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium meliloti (strain 1021) GN=glmS PE=3 SV=3 | 59 | 757 | 9.0E-111 |
| sp|P59362|GLMS_BRADU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glmS PE=3 SV=2 | 59 | 757 | 2.0E-110 |
| sp|Q7NA97|GLMS_PHOLL | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=glmS PE=3 SV=3 | 59 | 757 | 4.0E-108 |
| sp|Q5ZRP4|GLMS_LEGPH | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=glmS PE=3 SV=3 | 59 | 757 | 7.0E-108 |
| sp|Q5X153|GLMS_LEGPA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Legionella pneumophila (strain Paris) GN=glmS PE=3 SV=3 | 59 | 757 | 7.0E-108 |
| sp|Q8D3J0|GLMS_WIGBR | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Wigglesworthia glossinidia brevipalpis GN=glmS PE=3 SV=3 | 59 | 757 | 3.0E-107 |
| sp|Q6G322|GLMS_BARHE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=glmS PE=3 SV=3 | 59 | 757 | 7.0E-107 |
| sp|Q5WSX8|GLMS_LEGPL | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Legionella pneumophila (strain Lens) GN=glmS PE=3 SV=3 | 59 | 757 | 7.0E-107 |
| sp|Q67T12|GLMS_SYMTH | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=glmS PE=3 SV=3 | 59 | 757 | 1.0E-106 |
| sp|P9WN49|GLMS_MYCTU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glmS PE=1 SV=1 | 59 | 757 | 7.0E-106 |
| sp|P9WN48|GLMS_MYCTO | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glmS PE=3 SV=1 | 59 | 757 | 7.0E-106 |
| sp|P0A589|GLMS_MYCBO | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glmS PE=3 SV=2 | 59 | 757 | 7.0E-106 |
| sp|P57963|GLMS_PASMU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pasteurella multocida (strain Pm70) GN=glmS PE=3 SV=2 | 59 | 757 | 8.0E-106 |
| sp|P57138|GLMS_BUCAI | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=glmS PE=3 SV=2 | 59 | 757 | 2.0E-105 |
| sp|Q9HT25|GLMS_PSEAE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=glmS PE=3 SV=3 | 59 | 757 | 5.0E-105 |
| sp|Q7NIG8|GLMS_GLOVI | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Gloeobacter violaceus (strain PCC 7421) GN=glmS PE=3 SV=3 | 59 | 757 | 7.0E-105 |
| sp|Q7VKK4|GLMS_HAEDU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=glmS PE=3 SV=3 | 59 | 757 | 1.0E-103 |
| sp|P59499|GLMS_BUCBP | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=glmS PE=3 SV=2 | 59 | 757 | 2.0E-103 |
| sp|Q9WXZ5|GLMS_THEMA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glmS PE=3 SV=3 | 59 | 757 | 4.0E-103 |
| sp|Q5NRH4|GLMS_ZYMMO | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glmS PE=3 SV=3 | 59 | 757 | 9.0E-103 |
| sp|Q8TLL3|GLMS_METAC | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=glmS PE=3 SV=3 | 59 | 757 | 9.0E-102 |
| sp|Q8RG65|GLMS_FUSNN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=glmS PE=3 SV=3 | 59 | 757 | 2.0E-101 |
| sp|Q9ABV2|GLMS_CAUCR | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=glmS PE=3 SV=3 | 59 | 757 | 4.0E-101 |
| sp|Q8DJI6|GLMS_THEEB | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermosynechococcus elongatus (strain BP-1) GN=glmS PE=3 SV=3 | 59 | 757 | 2.0E-100 |
| sp|Q5QZH5|GLMS_IDILO | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=glmS PE=3 SV=3 | 59 | 757 | 2.0E-100 |
| sp|Q6F6U8|GLMS_ACIAD | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=glmS PE=3 SV=3 | 59 | 757 | 5.0E-100 |
| sp|P25195|NODM_RHIML | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium meliloti GN=nodM PE=2 SV=3 | 59 | 757 | 9.0E-100 |
| sp|Q83FU2|GLMS_TROWT | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Tropheryma whipplei (strain Twist) GN=glmS PE=3 SV=3 | 59 | 757 | 4.0E-98 |
| sp|Q83IA1|GLMS_TROW8 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Tropheryma whipplei (strain TW08/27) GN=glmS PE=3 SV=3 | 59 | 757 | 9.0E-98 |
| sp|Q74GH6|GLMS_GEOSL | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=glmS PE=3 SV=3 | 264 | 757 | 9.0E-98 |
| sp|Q7VRZ3|GLMS_BORPE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=glmS PE=3 SV=3 | 59 | 757 | 1.0E-96 |
| sp|Q8PCY1|GLMS_XANCP | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=glmS PE=3 SV=2 | 59 | 757 | 1.0E-96 |
| sp|Q9V249|GLMS_PYRAB | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=glmS PE=3 SV=3 | 59 | 757 | 4.0E-96 |
| sp|Q7W334|GLMS_BORPA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glmS PE=3 SV=3 | 59 | 757 | 5.0E-96 |
| sp|Q7WE36|GLMS_BORBR | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glmS PE=3 SV=3 | 59 | 757 | 5.0E-96 |
| sp|O26273|GLMS_METTH | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=glmS PE=3 SV=3 | 59 | 757 | 4.0E-95 |
| sp|Q87F28|GLMS_XYLFT | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=glmS PE=3 SV=2 | 59 | 757 | 2.0E-94 |
| sp|Q9PH05|GLMS_XYLFA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Xylella fastidiosa (strain 9a5c) GN=glmS PE=3 SV=3 | 59 | 757 | 1.0E-93 |
| sp|Q5L3P0|GLMS_GEOKA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Geobacillus kaustophilus (strain HTA426) GN=glmS PE=3 SV=3 | 59 | 757 | 2.0E-93 |
| sp|P72720|GLMS_SYNY3 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glmS PE=3 SV=3 | 59 | 757 | 6.0E-93 |
| sp|O83833|GLMS_TREPA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Treponema pallidum (strain Nichols) GN=glmS PE=3 SV=3 | 90 | 757 | 8.0E-93 |
| sp|Q8ZTZ0|GLMS_PYRAE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=glmS PE=3 SV=3 | 59 | 757 | 2.0E-92 |
| sp|Q8TZ14|GLMS_METKA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=glmS PE=3 SV=3 | 59 | 757 | 3.0E-92 |
| sp|O68280|GLMS_NOSS9 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Nostoc sp. (strain PCC 9229) GN=glmS PE=3 SV=3 | 59 | 757 | 8.0E-92 |
| sp|Q890U2|GLMS_CLOTE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Clostridium tetani (strain Massachusetts / E88) GN=glmS PE=3 SV=2 | 326 | 757 | 2.0E-91 |
| sp|Q56275|GLMS_ACIFR | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Acidithiobacillus ferrooxidans GN=glmS PE=3 SV=3 | 59 | 757 | 4.0E-91 |
| sp|Q9HT00|GLMS_HALSA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=glmS PE=3 SV=3 | 59 | 757 | 4.0E-91 |
| sp|O57981|GLMS_PYRHO | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=glmS PE=3 SV=3 | 59 | 757 | 2.0E-90 |
| sp|Q72HF4|GLMS_THET2 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=glmS PE=3 SV=3 | 326 | 757 | 2.0E-88 |
| sp|Q8PGH9|GLMS_XANAC | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Xanthomonas axonopodis pv. citri (strain 306) GN=glmS PE=3 SV=2 | 59 | 757 | 2.0E-88 |
| sp|Q8R841|GLMS_CALS4 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=glmS PE=3 SV=3 | 326 | 757 | 2.0E-87 |
| sp|Q8ETM5|GLMS_OCEIH | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glmS PE=3 SV=3 | 59 | 757 | 6.0E-87 |
| sp|Q663R1|GLMS_YERPS | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=glmS PE=3 SV=3 | 309 | 757 | 2.0E-86 |
| sp|Q8Z9S8|GLMS_YERPE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Yersinia pestis GN=glmS PE=3 SV=3 | 309 | 757 | 2.0E-86 |
| sp|Q8NND3|GLMS_CORGL | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=glmS PE=3 SV=2 | 326 | 757 | 5.0E-86 |
| sp|Q97SQ9|GLMS_STRPN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glmS PE=3 SV=3 | 59 | 757 | 8.0E-86 |
| sp|Q9PMT4|GLMS_CAMJE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=glmS PE=3 SV=3 | 59 | 757 | 1.0E-85 |
| sp|Q56213|GLMS_THET8 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=glmS PE=3 SV=4 | 326 | 757 | 1.0E-85 |
| sp|Q88BX8|GLMS_PSEPK | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pseudomonas putida (strain KT2440) GN=glmS PE=3 SV=2 | 297 | 757 | 6.0E-85 |
| sp|Q8XHZ7|GLMS_CLOPE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Clostridium perfringens (strain 13 / Type A) GN=glmS PE=3 SV=3 | 326 | 757 | 2.0E-84 |
| sp|Q821Z7|GLMS_CHLCV | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydophila caviae (strain GPIC) GN=glmS PE=3 SV=3 | 59 | 757 | 2.0E-84 |
| sp|O86781|GLMS_STRCO | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glmS PE=3 SV=3 | 326 | 757 | 3.0E-83 |
| sp|Q9YCQ6|GLMS_AERPE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=glmS PE=3 SV=3 | 59 | 757 | 2.0E-82 |
| sp|Q577Y1|GLMS_BRUAB | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella abortus biovar 1 (strain 9-941) GN=glmS PE=3 SV=3 | 326 | 757 | 3.0E-81 |
| sp|Q8CY30|GLMS_BRUSU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella suis biovar 1 (strain 1330) GN=glmS PE=3 SV=3 | 326 | 757 | 3.0E-81 |
| sp|Q6AD32|GLMS_LEIXX | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glmS PE=3 SV=3 | 326 | 757 | 1.0E-80 |
| sp|Q8YC47|GLMS_BRUME | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=glmS PE=3 SV=4 | 326 | 757 | 1.0E-80 |
| sp|Q8CX33|GLMS_SHEON | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Shewanella oneidensis (strain MR-1) GN=glmS PE=3 SV=3 | 309 | 757 | 1.0E-80 |
| sp|Q9Z6U0|GLMS_CHLPN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydia pneumoniae GN=glmS PE=3 SV=4 | 59 | 757 | 3.0E-80 |
| sp|O84823|GLMS_CHLTR | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=glmS PE=3 SV=3 | 59 | 757 | 3.0E-80 |
| sp|O68956|GLMS_MYCS2 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glmS PE=3 SV=3 | 326 | 757 | 6.0E-80 |
| sp|P94323|NODM_BRADU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodM PE=3 SV=3 | 326 | 757 | 2.0E-78 |
| sp|Q87TT8|GLMS_PSESM | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glmS PE=3 SV=2 | 326 | 757 | 2.0E-78 |
| sp|P08633|NODM_RHILV | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium leguminosarum bv. viciae GN=nodM PE=3 SV=3 | 326 | 757 | 1.0E-77 |
| sp|O19908|GLMS_CYACA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Cyanidium caldarium GN=glmS PE=3 SV=3 | 59 | 757 | 3.0E-77 |
| sp|Q98LX5|GLMS_RHILO | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium loti (strain MAFF303099) GN=glmS PE=3 SV=3 | 326 | 757 | 7.0E-77 |
| sp|Q8UEH1|GLMS_AGRFC | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glmS PE=3 SV=3 | 326 | 757 | 2.0E-76 |
| sp|Q8U4D1|GLMS_PYRFU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=glmS PE=3 SV=3 | 326 | 757 | 1.0E-75 |
| sp|Q9ZJ94|GLMS_HELPJ | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=glmS PE=3 SV=3 | 59 | 757 | 3.0E-75 |
| sp|Q58815|GLMS_METJA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=glmS PE=3 SV=3 | 128 | 757 | 5.0E-75 |
| sp|Q5JH71|GLMS_THEKO | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=glmS PE=3 SV=3 | 326 | 757 | 1.0E-74 |
| sp|Q4J6D9|GLMS_SULAC | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=glmS PE=3 SV=3 | 59 | 757 | 1.0E-74 |
| sp|O26060|GLMS_HELPY | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=glmS PE=3 SV=3 | 59 | 757 | 4.0E-73 |
| sp|Q8EZQ1|GLMS_LEPIN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=glmS PE=3 SV=3 | 307 | 757 | 1.0E-72 |
| sp|Q72V57|GLMS_LEPIC | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=glmS PE=3 SV=3 | 307 | 757 | 1.0E-72 |
| sp|Q8Q038|GLMS_METMA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=glmS PE=3 SV=2 | 326 | 757 | 5.0E-69 |
| sp|Q6LWM9|GLMS_METMP | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanococcus maripaludis (strain S2 / LL) GN=glmS PE=1 SV=2 | 59 | 757 | 8.0E-68 |
| sp|Q9KG45|GLMS_BACHD | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=glmS PE=3 SV=3 | 329 | 757 | 7.0E-66 |
| sp|A2P2R3|YM084_YEAST | Putative glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR084W PE=3 SV=1 | 59 | 281 | 1.0E-65 |
| sp|C8ZET7|YM084_YEAS8 | Putative glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=EC1118_1M3_2520g PE=3 SV=1 | 59 | 281 | 3.0E-64 |
| sp|Q5FUY5|GLMS_GLUOX | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Gluconobacter oxydans (strain 621H) GN=glmS PE=3 SV=3 | 326 | 757 | 8.0E-63 |
| sp|Q65P46|GLMS_BACLD | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glmS PE=3 SV=3 | 329 | 757 | 5.0E-62 |
| sp|Q8CRL1|GLMS_STAES | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glmS PE=3 SV=3 | 266 | 757 | 2.0E-61 |
| sp|Q5HM69|GLMS_STAEQ | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glmS PE=3 SV=3 | 266 | 757 | 2.0E-61 |
| sp|Q5WLG7|GLMS_BACSK | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus clausii (strain KSM-K16) GN=glmS PE=3 SV=3 | 329 | 757 | 5.0E-61 |
| sp|Q73F49|GLMS_BACC1 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glmS PE=3 SV=3 | 329 | 757 | 3.0E-60 |
| sp|Q81VN5|GLMS_BACAN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus anthracis GN=glmS PE=3 SV=3 | 329 | 757 | 3.0E-60 |
| sp|Q6HPL2|GLMS_BACHK | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glmS PE=3 SV=3 | 329 | 757 | 4.0E-60 |
| sp|Q722H1|GLMS_LISMF | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Listeria monocytogenes serotype 4b (strain F2365) GN=glmS PE=3 SV=3 | 329 | 757 | 4.0E-60 |
| sp|Q92DS8|GLMS_LISIN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=glmS PE=3 SV=3 | 329 | 757 | 4.0E-60 |
| sp|Q81J01|GLMS_BACCR | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glmS PE=3 SV=3 | 329 | 757 | 6.0E-60 |
| sp|Q8Y915|GLMS_LISMO | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=glmS PE=3 SV=3 | 329 | 757 | 2.0E-59 |
| sp|P0CI73|GLMS_BACSU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus subtilis (strain 168) GN=glmS PE=3 SV=1 | 329 | 757 | 5.0E-59 |
| sp|E0U070|GLMS_BACPZ | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) GN=glmS PE=3 SV=1 | 329 | 757 | 1.0E-58 |
| sp|Q88YE7|GLMS_LACPL | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glmS PE=3 SV=2 | 329 | 757 | 2.0E-58 |
| sp|P64228|GLMS_STAAN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain N315) GN=glmS PE=1 SV=2 | 329 | 757 | 8.0E-58 |
| sp|P64227|GLMS_STAAM | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glmS PE=3 SV=2 | 329 | 757 | 8.0E-58 |
| sp|Q8NVE6|GLMS_STAAW | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain MW2) GN=glmS PE=3 SV=2 | 329 | 757 | 1.0E-57 |
| sp|Q6G7F8|GLMS_STAAS | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain MSSA476) GN=glmS PE=3 SV=3 | 329 | 757 | 1.0E-57 |
| sp|Q6GES3|GLMS_STAAR | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain MRSA252) GN=glmS PE=3 SV=3 | 329 | 757 | 1.0E-57 |
| sp|Q5HE49|GLMS_STAAC | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain COL) GN=glmS PE=3 SV=3 | 329 | 757 | 1.0E-57 |
| sp|Q8DRA8|GLMS_STRR6 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glmS PE=3 SV=3 | 328 | 757 | 2.0E-56 |
| sp|Q8DZZ7|GLMS_STRA5 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glmS PE=3 SV=3 | 328 | 757 | 2.0E-56 |
| sp|Q8E5P8|GLMS_STRA3 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glmS PE=3 SV=3 | 328 | 757 | 3.0E-56 |
| sp|Q9PLA4|GLMS_CHLMU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydia muridarum (strain MoPn / Nigg) GN=glmS PE=3 SV=3 | 326 | 757 | 3.0E-56 |
| sp|P0DB33|GLMS_STRPQ | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=glmS PE=3 SV=1 | 328 | 757 | 1.0E-55 |
| sp|P0DB32|GLMS_STRP3 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=glmS PE=3 SV=1 | 328 | 757 | 1.0E-55 |
| sp|Q8P0S7|GLMS_STRP8 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=glmS PE=3 SV=2 | 328 | 757 | 1.0E-55 |
| sp|Q99ZD3|GLMS_STRP1 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M1 GN=glmS PE=3 SV=3 | 328 | 757 | 2.0E-55 |
| sp|Q9CGT6|GLMS_LACLA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glmS PE=3 SV=2 | 328 | 757 | 2.0E-54 |
| sp|Q5L589|GLMS_CHLAB | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=glmS PE=3 SV=3 | 326 | 757 | 2.0E-53 |
| sp|Q8DTY0|GLMS_STRMU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=glmS PE=3 SV=3 | 328 | 757 | 5.0E-53 |
| sp|Q5XBV6|GLMS_STRP6 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=glmS PE=3 SV=3 | 328 | 757 | 2.0E-52 |
| sp|Q7T6X6|GFAT_MIMIV | Probable glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L619 PE=3 SV=4 | 398 | 757 | 2.0E-51 |
| sp|Q8NND3|GLMS_CORGL | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=glmS PE=3 SV=2 | 59 | 262 | 4.0E-37 |
| sp|Q663R1|GLMS_YERPS | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=glmS PE=3 SV=3 | 59 | 261 | 2.0E-35 |
| sp|Q8Z9S8|GLMS_YERPE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Yersinia pestis GN=glmS PE=3 SV=3 | 59 | 261 | 2.0E-35 |
| sp|O68956|GLMS_MYCS2 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glmS PE=3 SV=3 | 59 | 262 | 3.0E-34 |
| sp|Q56206|GLMS_SPHYA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (Fragment) OS=Sphingobium yanoikuyae GN=glmS PE=3 SV=1 | 604 | 757 | 3.0E-33 |
| sp|Q8Q038|GLMS_METMA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=glmS PE=3 SV=2 | 59 | 262 | 5.0E-33 |
| sp|Q890U2|GLMS_CLOTE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Clostridium tetani (strain Massachusetts / E88) GN=glmS PE=3 SV=2 | 59 | 262 | 6.0E-33 |
| sp|Q88BX8|GLMS_PSEPK | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pseudomonas putida (strain KT2440) GN=glmS PE=3 SV=2 | 59 | 262 | 2.0E-32 |
| sp|Q8CX33|GLMS_SHEON | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Shewanella oneidensis (strain MR-1) GN=glmS PE=3 SV=3 | 59 | 261 | 2.0E-32 |
| sp|O86781|GLMS_STRCO | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glmS PE=3 SV=3 | 59 | 262 | 3.0E-32 |
| sp|Q87TT8|GLMS_PSESM | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glmS PE=3 SV=2 | 59 | 262 | 5.0E-32 |
| sp|Q74GH6|GLMS_GEOSL | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=glmS PE=3 SV=3 | 59 | 262 | 3.0E-31 |
| sp|Q8R841|GLMS_CALS4 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=glmS PE=3 SV=3 | 59 | 262 | 3.0E-31 |
| sp|Q5JH71|GLMS_THEKO | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=glmS PE=3 SV=3 | 59 | 262 | 6.0E-31 |
| sp|Q5WLG7|GLMS_BACSK | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus clausii (strain KSM-K16) GN=glmS PE=3 SV=3 | 59 | 262 | 1.0E-30 |
| sp|Q8XHZ7|GLMS_CLOPE | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Clostridium perfringens (strain 13 / Type A) GN=glmS PE=3 SV=3 | 59 | 262 | 3.0E-30 |
| sp|Q8U4D1|GLMS_PYRFU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=glmS PE=3 SV=3 | 59 | 262 | 3.0E-30 |
| sp|Q72HF4|GLMS_THET2 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=glmS PE=3 SV=3 | 59 | 262 | 6.0E-29 |
| sp|Q6AD32|GLMS_LEIXX | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glmS PE=3 SV=3 | 59 | 262 | 6.0E-29 |
| sp|Q8CY30|GLMS_BRUSU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella suis biovar 1 (strain 1330) GN=glmS PE=3 SV=3 | 59 | 261 | 8.0E-29 |
| sp|Q56213|GLMS_THET8 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=glmS PE=3 SV=4 | 59 | 262 | 9.0E-29 |
| sp|P64228|GLMS_STAAN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain N315) GN=glmS PE=1 SV=2 | 59 | 262 | 1.0E-28 |
| sp|P64227|GLMS_STAAM | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glmS PE=3 SV=2 | 59 | 262 | 1.0E-28 |
| sp|Q8NVE6|GLMS_STAAW | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain MW2) GN=glmS PE=3 SV=2 | 59 | 262 | 1.0E-28 |
| sp|Q6G7F8|GLMS_STAAS | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain MSSA476) GN=glmS PE=3 SV=3 | 59 | 262 | 1.0E-28 |
| sp|Q6GES3|GLMS_STAAR | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain MRSA252) GN=glmS PE=3 SV=3 | 59 | 262 | 1.0E-28 |
| sp|Q5HE49|GLMS_STAAC | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus aureus (strain COL) GN=glmS PE=3 SV=3 | 59 | 262 | 1.0E-28 |
| sp|Q8DRA8|GLMS_STRR6 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glmS PE=3 SV=3 | 59 | 262 | 1.0E-28 |
| sp|P0DB33|GLMS_STRPQ | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=glmS PE=3 SV=1 | 59 | 262 | 1.0E-28 |
| sp|P0DB32|GLMS_STRP3 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=glmS PE=3 SV=1 | 59 | 262 | 1.0E-28 |
| sp|Q8P0S7|GLMS_STRP8 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=glmS PE=3 SV=2 | 59 | 262 | 1.0E-28 |
| sp|P08633|NODM_RHILV | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium leguminosarum bv. viciae GN=nodM PE=3 SV=3 | 59 | 261 | 2.0E-28 |
| sp|Q99ZD3|GLMS_STRP1 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M1 GN=glmS PE=3 SV=3 | 59 | 262 | 2.0E-28 |
| sp|Q5XBV6|GLMS_STRP6 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=glmS PE=3 SV=3 | 59 | 262 | 2.0E-28 |
| sp|Q9KG45|GLMS_BACHD | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=glmS PE=3 SV=3 | 59 | 263 | 3.0E-28 |
| sp|Q8YC47|GLMS_BRUME | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=glmS PE=3 SV=4 | 59 | 261 | 4.0E-28 |
| sp|Q8DTY0|GLMS_STRMU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=glmS PE=3 SV=3 | 59 | 262 | 4.0E-28 |
| sp|Q577Y1|GLMS_BRUAB | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Brucella abortus biovar 1 (strain 9-941) GN=glmS PE=3 SV=3 | 59 | 261 | 5.0E-28 |
| sp|Q9CGT6|GLMS_LACLA | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glmS PE=3 SV=2 | 59 | 262 | 9.0E-28 |
| sp|Q81VN5|GLMS_BACAN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus anthracis GN=glmS PE=3 SV=3 | 59 | 262 | 2.0E-27 |
| sp|Q6HPL2|GLMS_BACHK | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glmS PE=3 SV=3 | 59 | 262 | 2.0E-27 |
| sp|Q81J01|GLMS_BACCR | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glmS PE=3 SV=3 | 59 | 262 | 2.0E-27 |
| sp|Q8E5P8|GLMS_STRA3 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glmS PE=3 SV=3 | 59 | 262 | 2.0E-27 |
| sp|Q98LX5|GLMS_RHILO | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Rhizobium loti (strain MAFF303099) GN=glmS PE=3 SV=3 | 59 | 261 | 3.0E-27 |
| sp|Q8DZZ7|GLMS_STRA5 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glmS PE=3 SV=3 | 59 | 262 | 3.0E-27 |
| sp|E0U070|GLMS_BACPZ | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) GN=glmS PE=3 SV=1 | 59 | 262 | 6.0E-27 |
| sp|Q65P46|GLMS_BACLD | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glmS PE=3 SV=3 | 59 | 262 | 7.0E-27 |
| sp|P0CI73|GLMS_BACSU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus subtilis (strain 168) GN=glmS PE=3 SV=1 | 59 | 262 | 7.0E-27 |
| sp|Q73F49|GLMS_BACC1 | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glmS PE=3 SV=3 | 59 | 262 | 8.0E-27 |
| sp|Q9PLA4|GLMS_CHLMU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydia muridarum (strain MoPn / Nigg) GN=glmS PE=3 SV=3 | 59 | 266 | 3.0E-26 |
| sp|Q8UEH1|GLMS_AGRFC | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glmS PE=3 SV=3 | 59 | 261 | 4.0E-26 |
| sp|Q8CRL1|GLMS_STAES | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glmS PE=3 SV=3 | 59 | 262 | 7.0E-26 |
| sp|Q5HM69|GLMS_STAEQ | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glmS PE=3 SV=3 | 59 | 262 | 7.0E-26 |
| sp|Q5L589|GLMS_CHLAB | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=glmS PE=3 SV=3 | 59 | 262 | 1.0E-25 |
| sp|Q88YE7|GLMS_LACPL | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glmS PE=3 SV=2 | 59 | 262 | 9.0E-25 |
| sp|Q8EZQ1|GLMS_LEPIN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=glmS PE=3 SV=3 | 59 | 261 | 2.0E-24 |
| sp|Q72V57|GLMS_LEPIC | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=glmS PE=3 SV=3 | 59 | 261 | 2.0E-24 |
| sp|Q5FUY5|GLMS_GLUOX | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Gluconobacter oxydans (strain 621H) GN=glmS PE=3 SV=3 | 59 | 261 | 4.0E-24 |
| sp|P94323|NODM_BRADU | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodM PE=3 SV=3 | 59 | 261 | 5.0E-24 |
| sp|Q92DS8|GLMS_LISIN | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=glmS PE=3 SV=3 | 59 | 261 | 1.0E-23 |
| sp|Q8Y915|GLMS_LISMO | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=glmS PE=3 SV=3 | 59 | 261 | 2.0E-23 |
| sp|Q722H1|GLMS_LISMF | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Listeria monocytogenes serotype 4b (strain F2365) GN=glmS PE=3 SV=3 | 59 | 261 | 4.0E-23 |
| sp|Q7T6X6|GFAT_MIMIV | Probable glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L619 PE=3 SV=4 | 59 | 261 | 2.0E-17 |
| sp|Q52846|NODM_RHILT | Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (Fragment) OS=Rhizobium leguminosarum bv. trifolii GN=nodM PE=3 SV=1 | 106 | 205 | 7.0E-15 |
| sp|O32157|FRLB_BACSU | Fructosamine deglycase FrlB OS=Bacillus subtilis (strain 168) GN=frlB PE=1 SV=1 | 445 | 677 | 3.0E-14 |
| sp|Q57657|PUR1_METJA | Amidophosphoribosyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=purF PE=3 SV=3 | 59 | 261 | 5.0E-14 |
| sp|P00497|PUR1_BACSU | Amidophosphoribosyltransferase OS=Bacillus subtilis (strain 168) GN=purF PE=1 SV=2 | 56 | 265 | 5.0E-13 |
| sp|Q6GI14|PUR1_STAAR | Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=purF PE=3 SV=1 | 53 | 265 | 1.0E-12 |
| sp|P35433|PUR1_RAT | Amidophosphoribosyltransferase OS=Rattus norvegicus GN=Ppat PE=1 SV=1 | 60 | 261 | 1.0E-12 |
| sp|Q8NX91|PUR1_STAAW | Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain MW2) GN=purF PE=3 SV=1 | 53 | 265 | 2.0E-12 |
| sp|Q6GAE3|PUR1_STAAS | Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=purF PE=3 SV=1 | 53 | 265 | 2.0E-12 |
| sp|Q5HH14|PUR1_STAAC | Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain COL) GN=purF PE=3 SV=1 | 53 | 265 | 2.0E-12 |
| sp|P99164|PUR1_STAAN | Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain N315) GN=purF PE=1 SV=1 | 53 | 265 | 2.0E-12 |
| sp|P65831|PUR1_STAAM | Amidophosphoribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purF PE=3 SV=1 | 53 | 265 | 2.0E-12 |
| sp|Q06203|PUR1_HUMAN | Amidophosphoribosyltransferase OS=Homo sapiens GN=PPAT PE=1 SV=1 | 60 | 261 | 4.0E-12 |
| sp|P28173|PUR1_CHICK | Amidophosphoribosyltransferase OS=Gallus gallus GN=PPAT PE=2 SV=1 | 60 | 300 | 9.0E-12 |
| sp|Q8CT30|PUR1_STAES | Amidophosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purF PE=3 SV=1 | 53 | 261 | 2.0E-10 |
| sp|Q5HQA0|PUR1_STAEQ | Amidophosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purF PE=3 SV=1 | 53 | 261 | 2.0E-10 |
| sp|Q27601|PUR1_DROME | Amidophosphoribosyltransferase OS=Drosophila melanogaster GN=Prat PE=1 SV=2 | 47 | 203 | 1.0E-08 |
| sp|O26293|Y191_METTH | Putative glutamine amidotransferase MTH_191 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_191 PE=3 SV=3 | 140 | 266 | 1.0E-08 |
| sp|Q55621|PUR1_SYNY3 | Amidophosphoribosyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purF PE=3 SV=1 | 58 | 262 | 3.0E-08 |
| sp|Q96Y49|QUEC2_SULTO | 7-cyano-7-deazaguanine synthase 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=queC2 PE=3 SV=1 | 59 | 260 | 6.0E-08 |
| sp|O87390|GLXB_RHIME | Glutamine amidotransferase-like protein GlxB OS=Rhizobium meliloti (strain 1021) GN=glxB PE=3 SV=3 | 107 | 239 | 1.0E-07 |
| sp|P35853|PUR1_LACCA | Amidophosphoribosyltransferase (Fragment) OS=Lactobacillus casei GN=purF PE=3 SV=2 | 56 | 261 | 2.0E-07 |
| sp|Q55038|PUR1_SYNE7 | Amidophosphoribosyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=purF PE=3 SV=1 | 58 | 203 | 2.0E-06 |
| sp|Q9V253|PUR1_PYRAB | Amidophosphoribosyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=purF PE=3 SV=1 | 58 | 290 | 3.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:1901135 | carbohydrate derivative metabolic process | Yes |
| GO:0097367 | carbohydrate derivative binding | Yes |
| GO:0008152 | metabolic process | No |
| GO:0003674 | molecular_function | No |
| GO:0005488 | binding | No |
| GO:0008150 | biological_process | No |
| GO:0071704 | organic substance metabolic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 18 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 13 | 35 | 22 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 561.07 | 178.46 | 943.67 |
| Initials | Initials knots | 248.83 | 130.43 | 367.22 |
| Pileal_Stipeal_center | Stage I stipe center | 608.94 | 252.17 | 965.71 |
| Pileal_Stipeal_shell | Stage I stipe shell | 382.18 | 182.83 | 581.53 |
| DIF_stipe_center | Stage II stipe center | 660.09 | 269.26 | 1050.93 |
| DIF_stipe_shell | Stage II stipe shell | 938.66 | 295.22 | 1582.10 |
| DIF_stipe_skin | Stage II stipe skin | 586.53 | 249.97 | 923.08 |
| DIF_cap_skin | Stage II cap skin | 585.28 | 252.02 | 918.55 |
| DIF_cap_tissue | Stage II cap tissue | 642.71 | 266.62 | 1018.80 |
| DIF_gill_tissue | Stage II gill tissue | 531.60 | 230.74 | 832.46 |
| YFB_stipe_center | Young fruiting body stipe center | 666.34 | 254.49 | 1078.20 |
| YFB_stipe_shell | Young fruiting body stipe shell | 912.36 | 324.30 | 1500.43 |
| YFB_stipe_skin | Young fruiting body stipe skin | 609.00 | 250.87 | 967.13 |
| YFB_cap_skin | Young fruiting body cap skin | 620.83 | 262.46 | 979.19 |
| YFB_cap_tissue | Young fruiting body cap tissue | 1209.81 | 358.09 | 2061.54 |
| YFB_gill_tissue | Young fruiting body gill tissue | 520.23 | 224.23 | 816.24 |
| YFB_veil | Young fruiting body veil | 585.90 | 250.63 | 921.17 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.948619 | no |
| Casing | YFB_stipe_center | 0.816602 | no |
| Casing | YFB_stipe_shell | 0.363051 | no |
| Casing | YFB_stipe_skin | 0.921188 | no |
| Casing | YFB_cap_skin | 0.893058 | no |
| Casing | YFB_cap_tissue | 0.099106 | no |
| Casing | YFB_gill_tissue | 0.925204 | no |
| Casing | YFB_veil | 0.958334 | no |
| Casing | Initials | 0.048834 | yes |
| Casing | Pileal_Stipeal_center | 0.921595 | no |
| Casing | Pileal_Stipeal_shell | 0.450943 | no |
| Casing | DIF_stipe_center | 0.822573 | no |
| Casing | DIF_stipe_shell | 0.348314 | no |
| Casing | DIF_stipe_skin | 0.957930 | no |
| Casing | DIF_cap_skin | 0.959634 | no |
| Casing | DIF_cap_tissue | 0.858905 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.713353 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.234297 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.841231 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.802427 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.049257 | yes |
| DIF_gill_tissue | YFB_gill_tissue | 0.978263 | no |
| DIF_gill_tissue | YFB_veil | 0.889219 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.596449 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.908990 | no |
| YFB_stipe_center | YFB_cap_skin | 0.924409 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.213417 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.672839 | no |
| YFB_stipe_center | YFB_veil | 0.855325 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.437800 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.438864 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.657752 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.207757 | no |
| YFB_stipe_shell | YFB_veil | 0.348877 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.980444 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.122622 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.811072 | no |
| YFB_stipe_skin | YFB_veil | 0.960768 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.123805 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.766384 | no |
| YFB_cap_skin | YFB_veil | 0.936068 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.040279 | yes |
| YFB_cap_tissue | YFB_veil | 0.087927 | no |
| YFB_gill_tissue | YFB_veil | 0.859067 | no |
| Initials | DIF_gill_tissue | 0.032038 | yes |
| Initials | YFB_stipe_center | 0.006742 | yes |
| Initials | YFB_stipe_shell | 0.000613 | yes |
| Initials | YFB_stipe_skin | 0.014081 | yes |
| Initials | YFB_cap_skin | 0.008791 | yes |
| Initials | YFB_cap_tissue | 0.000613 | yes |
| Initials | YFB_gill_tissue | 0.032504 | yes |
| Initials | YFB_veil | 0.011968 | yes |
| Initials | Pileal_Stipeal_center | 0.012577 | yes |
| Initials | Pileal_Stipeal_shell | 0.261860 | no |
| Initials | DIF_stipe_center | 0.004548 | yes |
| Initials | DIF_stipe_shell | 0.001625 | yes |
| Initials | DIF_stipe_skin | 0.014668 | yes |
| Initials | DIF_cap_skin | 0.010412 | yes |
| Initials | DIF_cap_tissue | 0.009446 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.839932 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.906383 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.434998 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.999824 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.980187 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.122909 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.807156 | no |
| Pileal_Stipeal_center | YFB_veil | 0.959501 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.281350 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.914632 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.419051 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.961204 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.958803 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.944320 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.483821 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.192412 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.031800 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.281155 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.224601 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.004160 | yes |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.519091 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.307186 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.180703 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.032742 | yes |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.318876 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.316605 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.212151 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.712265 | no |
| DIF_stipe_center | YFB_stipe_center | 0.990559 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.561252 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.914359 | no |
| DIF_stipe_center | YFB_cap_skin | 0.932928 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.182058 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.673724 | no |
| DIF_stipe_center | YFB_veil | 0.860975 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.536822 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.864132 | no |
| DIF_stipe_center | DIF_cap_skin | 0.858214 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.972475 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.230883 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.569030 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.975000 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.417115 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.419635 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.713879 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.204585 | no |
| DIF_stipe_shell | YFB_veil | 0.340119 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.350157 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.344404 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.500031 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.887683 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.856524 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.358752 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.960941 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.937466 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.089130 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.857848 | no |
| DIF_stipe_skin | YFB_veil | 0.998252 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.997123 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.899983 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.891173 | no |
| DIF_cap_skin | YFB_stipe_center | 0.853079 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.360784 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.959232 | no |
| DIF_cap_skin | YFB_cap_skin | 0.935014 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.089805 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.861007 | no |
| DIF_cap_skin | YFB_veil | 0.998233 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.897633 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.760197 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.964272 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.520132 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.945432 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.963939 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.159722 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.722928 | no |
| DIF_cap_tissue | YFB_veil | 0.896433 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|109210 MPRVGVATACLHVFVSSGDLIYAFFAAIHLLPFLTSRVCLSYIPSHIPAALFFSRLIDMCGIFGYCNYLKEKRRE EVLEILCAGLARQEYRGYDSAGLVIDGDKPGSVEYFKEVGKVAGLRKKIAGSQLDVEKSYIAQVSIAHTRWATHG PPSERNCHPVRSDQNSEFVIVHNGIVTNSAELRQVLQKRGYQFKTDTDTEAVAILTKYIFDSQGSARRLTFTEIV KAVLKELEGSFAFVFKSSHFPNEVVTARRGSPLLIGVKTDKKLKVDFVDVEFAGQDPKETLPESIQANSLTGLAV PSANPKVFRTQSRTFITEDGFPQPIEFFIASDAAAIIEHTKRVLYLEDDDIAHIADGELQIHRLRRKEEGHQTPS QIATTRTIETLELEIAAIMKGKFDTFMQKEIYEQPESVVNTMRGRVNFDEQRITLGGLRAYLPIMRRSRRIVFIA CGTSYHSCLATRAIFEELTEIPVGVELASDFLDRKTPIFRDDVCVFLSQSGETADTILAMRYCMDRGALCVGVVN TVGSTISRETHCGVHINAGPEVGVASTKAYTSQYVALMMIALQLSEDRISFTERRNQIINGLHSLSAQITKVLEL DPILEELAEGIHKNKSLLIMGRGMQHATCLEGALKIKEISYMHSEGILAGELKHGPLALIDENMPVIIIMTRDSL YPKVQSAFAQITARKARPIVLCNEGDDGIPANATTIRVPQTVDSLQGLLNIIPLQLLSYHLAVKNGCDVDFPRNL AKSVTVE* |
| Coding | >AgabiH97|109210 ATGCCGCGCGTTGGGGTTGCAACAGCTTGTTTGCACGTATTTGTGTCTAGCGGGGACTTAATATACGCGTTCTTC GCTGCTATCCATCTTCTCCCTTTCCTTACTTCACGCGTCTGCCTCTCTTATATCCCCTCACATATACCAGCAGCT CTTTTCTTCTCTCGCCTAATAGACATGTGTGGAATATTCGGCTATTGCAACTACTTGAAGGAAAAGCGCCGTGAA GAGGTTCTGGAAATCCTCTGTGCTGGCCTCGCTCGTCAGGAATATCGTGGATATGACTCTGCTGGTCTTGTCATT GATGGCGATAAGCCCGGATCTGTTGAGTACTTCAAAGAAGTCGGGAAGGTCGCTGGTCTTCGCAAGAAGATAGCT GGTTCCCAACTCGATGTCGAGAAATCCTACATTGCTCAGGTTTCTATTGCGCACACACGATGGGCCACTCACGGC CCCCCTTCTGAACGCAACTGCCACCCTGTTCGATCGGATCAGAATTCCGAATTTGTTATCGTCCATAATGGAATC GTCACTAACAGTGCCGAGCTGAGGCAAGTCCTCCAAAAGCGTGGATACCAATTCAAAACCGATACCGATACTGAG GCCGTCGCTATCCTCACCAAGTATATCTTCGACTCACAAGGGAGTGCCAGACGCCTCACTTTCACTGAAATTGTC AAGGCTGTTCTCAAGGAGCTCGAGGGCTCCTTTGCGTTCGTTTTCAAATCCTCCCACTTTCCTAATGAAGTCGTC ACCGCTCGTCGCGGTTCACCACTTTTGATCGGCGTGAAGACCGATAAGAAGTTGAAGGTTGACTTTGTTGATGTT GAATTTGCGGGTCAAGACCCCAAGGAAACCTTACCCGAGTCGATTCAAGCCAACTCGCTGACTGGCCTCGCTGTC CCCTCTGCAAACCCGAAGGTCTTTCGTACCCAATCCCGCACTTTCATAACGGAAGACGGCTTCCCTCAGCCCATC GAGTTCTTCATCGCGTCTGACGCAGCGGCTATAATTGAGCACACTAAACGTGTTCTCTACCTCGAAGATGACGAT ATCGCTCACATTGCTGATGGTGAATTACAAATTCATCGTCTCCGTCGTAAGGAGGAAGGGCATCAGACACCCAGT CAAATTGCCACCACACGCACCATCGAGACTCTCGAGCTAGAAATTGCGGCCATCATGAAGGGCAAGTTCGATACT TTCATGCAAAAAGAAATTTATGAACAGCCGGAATCGGTCGTCAACACTATGCGAGGTCGTGTTAACTTCGACGAA CAAAGAATTACCCTTGGTGGCCTGCGCGCGTATCTTCCCATCATGCGTCGCAGCAGGCGTATTGTTTTCATTGCC TGTGGCACCAGTTACCATTCATGCTTGGCTACCCGTGCGATCTTCGAGGAATTAACCGAAATCCCGGTTGGTGTT GAATTGGCTAGCGATTTCTTGGATCGGAAGACTCCTATTTTCCGTGACGACGTGTGCGTCTTCCTAAGCCAGAGT GGAGAGACTGCAGATACCATCCTGGCCATGCGTTATTGCATGGATCGTGGTGCCCTTTGTGTCGGTGTTGTCAAT ACTGTTGGTTCCACCATCTCTCGTGAGACCCATTGCGGTGTCCACATCAACGCTGGTCCCGAAGTCGGTGTCGCT TCTACTAAGGCCTACACCTCCCAATACGTTGCTCTCATGATGATTGCGCTACAACTTTCCGAGGATCGTATCTCC TTCACCGAACGAAGGAACCAAATTATCAATGGTCTCCACTCTCTTTCTGCTCAAATTACGAAGGTCCTTGAGCTC GACCCCATTCTCGAAGAACTTGCGGAAGGCATTCACAAGAATAAGAGTCTGCTGATAATGGGTCGTGGAATGCAG CATGCTACGTGTTTGGAGGGCGCCCTCAAAATCAAGGAGATCAGTTACATGCACTCCGAAGGTATTCTTGCTGGA GAGCTCAAGCATGGTCCCCTTGCTCTCATCGACGAGAACATGCCGGTTATTATAATCATGACCCGAGACTCGTTA TATCCCAAGGTCCAGTCCGCCTTTGCCCAGATCACCGCTCGCAAGGCTCGGCCCATTGTCCTTTGTAACGAGGGT GATGATGGTATCCCCGCCAACGCCACTACCATTCGCGTCCCTCAGACCGTCGATTCCCTTCAAGGACTTCTCAAC ATCATTCCTTTGCAACTCTTGAGTTACCACCTCGCTGTCAAGAACGGTTGCGACGTTGATTTCCCCCGTAACTTG GCCAAATCGGTCACTGTTGAGTAA |
| Transcript | >AgabiH97|109210 ATGCCGCGCGTTGGGGTTGCAACAGCTTGTTTGCACGTATTTGTGTCTAGCGGGGACTTAATATACGCGTTCTTC GCTGCTATCCATCTTCTCCCTTTCCTTACTTCACGCGTCTGCCTCTCTTATATCCCCTCACATATACCAGCAGCT CTTTTCTTCTCTCGCCTAATAGACATGTGTGGAATATTCGGCTATTGCAACTACTTGAAGGAAAAGCGCCGTGAA GAGGTTCTGGAAATCCTCTGTGCTGGCCTCGCTCGTCAGGAATATCGTGGATATGACTCTGCTGGTCTTGTCATT GATGGCGATAAGCCCGGATCTGTTGAGTACTTCAAAGAAGTCGGGAAGGTCGCTGGTCTTCGCAAGAAGATAGCT GGTTCCCAACTCGATGTCGAGAAATCCTACATTGCTCAGGTTTCTATTGCGCACACACGATGGGCCACTCACGGC CCCCCTTCTGAACGCAACTGCCACCCTGTTCGATCGGATCAGAATTCCGAATTTGTTATCGTCCATAATGGAATC GTCACTAACAGTGCCGAGCTGAGGCAAGTCCTCCAAAAGCGTGGATACCAATTCAAAACCGATACCGATACTGAG GCCGTCGCTATCCTCACCAAGTATATCTTCGACTCACAAGGGAGTGCCAGACGCCTCACTTTCACTGAAATTGTC AAGGCTGTTCTCAAGGAGCTCGAGGGCTCCTTTGCGTTCGTTTTCAAATCCTCCCACTTTCCTAATGAAGTCGTC ACCGCTCGTCGCGGTTCACCACTTTTGATCGGCGTGAAGACCGATAAGAAGTTGAAGGTTGACTTTGTTGATGTT GAATTTGCGGGTCAAGACCCCAAGGAAACCTTACCCGAGTCGATTCAAGCCAACTCGCTGACTGGCCTCGCTGTC CCCTCTGCAAACCCGAAGGTCTTTCGTACCCAATCCCGCACTTTCATAACGGAAGACGGCTTCCCTCAGCCCATC GAGTTCTTCATCGCGTCTGACGCAGCGGCTATAATTGAGCACACTAAACGTGTTCTCTACCTCGAAGATGACGAT ATCGCTCACATTGCTGATGGTGAATTACAAATTCATCGTCTCCGTCGTAAGGAGGAAGGGCATCAGACACCCAGT CAAATTGCCACCACACGCACCATCGAGACTCTCGAGCTAGAAATTGCGGCCATCATGAAGGGCAAGTTCGATACT TTCATGCAAAAAGAAATTTATGAACAGCCGGAATCGGTCGTCAACACTATGCGAGGTCGTGTTAACTTCGACGAA CAAAGAATTACCCTTGGTGGCCTGCGCGCGTATCTTCCCATCATGCGTCGCAGCAGGCGTATTGTTTTCATTGCC TGTGGCACCAGTTACCATTCATGCTTGGCTACCCGTGCGATCTTCGAGGAATTAACCGAAATCCCGGTTGGTGTT GAATTGGCTAGCGATTTCTTGGATCGGAAGACTCCTATTTTCCGTGACGACGTGTGCGTCTTCCTAAGCCAGAGT GGAGAGACTGCAGATACCATCCTGGCCATGCGTTATTGCATGGATCGTGGTGCCCTTTGTGTCGGTGTTGTCAAT ACTGTTGGTTCCACCATCTCTCGTGAGACCCATTGCGGTGTCCACATCAACGCTGGTCCCGAAGTCGGTGTCGCT TCTACTAAGGCCTACACCTCCCAATACGTTGCTCTCATGATGATTGCGCTACAACTTTCCGAGGATCGTATCTCC TTCACCGAACGAAGGAACCAAATTATCAATGGTCTCCACTCTCTTTCTGCTCAAATTACGAAGGTCCTTGAGCTC GACCCCATTCTCGAAGAACTTGCGGAAGGCATTCACAAGAATAAGAGTCTGCTGATAATGGGTCGTGGAATGCAG CATGCTACGTGTTTGGAGGGCGCCCTCAAAATCAAGGAGATCAGTTACATGCACTCCGAAGGTATTCTTGCTGGA GAGCTCAAGCATGGTCCCCTTGCTCTCATCGACGAGAACATGCCGGTTATTATAATCATGACCCGAGACTCGTTA TATCCCAAGGTCCAGTCCGCCTTTGCCCAGATCACCGCTCGCAAGGCTCGGCCCATTGTCCTTTGTAACGAGGGT GATGATGGTATCCCCGCCAACGCCACTACCATTCGCGTCCCTCAGACCGTCGATTCCCTTCAAGGACTTCTCAAC ATCATTCCTTTGCAACTCTTGAGTTACCACCTCGCTGTCAAGAACGGTTGCGACGTTGATTTCCCCCGTAACTTG GCCAAATCGGTCACTGTTGAGTAA |
| Gene | >AgabiH97|109210 ATGCCGCGCGTTGGGGTTGCAACAGCTTGTTTGCACGTATTTGTGTCTAGCGGGGACTTAATATACGCGTTCTTC GCTGCTATCCATCTTCTCCCTTTCCTTACTTCACGCGTCTGCCTCTCTTATATCCCCTCACATATACCAGCAGGT CTGTCTGCATTCATTGTCTACGTCGCCGACTCTACCTCACACCGTTTGACCTCTTCCTAGCTCTTTTCTTCTCTC GCCTAATAGACATGTGTGGAATATTCGGCTATTGCAACTACTTGAAGGAAAAGGTATGTTGCTCGATCGTGCATA TATCTATGTTCTTGCGCATATATACCATCCAATCGTTCTAACTGATCGTTGGCGGATGCGGTATCTGCGCTCGGT GATACGCAGCGGCCGGATACGTGCATATATGCACCTCTGATATCTTGTACACCACGAAGCTTACTGATGGTTCTT TTATCAGCGCCGTGAAGAGGTTCTGGAAATCCTCTGTGCTGGCCTCGCTCGTCAGGAATATCGTGGATATGACTC TGCTGGTCTTGTCATTGATGGCGATAAGCCCGGATCTGTTGAGTACTTCAAAGAAGTCGGGAAGGTCGCTGGTCT TCGCAAGAAGATAGCTGGTTCCCAACTCGATGTCGAGAAATCCTACATTGCTCAGGTTTCTATTGCGCACACACG ATGGGCCACTCACGGCCCCCCTTCTGAACGCAACTGCCACCCTGTTCGATCGGATCAGAATTCCGAATTTGTTAT CGTCCATAATGGAATCGTCACTAACAGTGCCGAGCTGAGGCAAGTCCTCCAAAAGCGTGGATACCAATTCAAAAC CGATACCGATACTGAGGCCGTCGCTATCCTCACCAAGTATATCTTCGACTCACAAGGGAGTGCCAGACGCCTCAC TTTCACTGAAATTGTCAAGGCTGTTCTCAAGGAGCTCGAGGGCTCCTTTGCGTTCGTTTTCAAATCCTCCCACTT TCCTAATGAAGTCGTCACCGCTCGTCGCGGTTCACCACTTTTGATCGGCGTGAAGACCGATAAGAAGTTGAAGGT TGACTTTGTTGATGTTGAATTTGCGGGTCAAGACCCCAAGGAAACCTTACCCGAGTCGAGTATGTTTACTTTTAT TTATTTTTTATATGCTTAAATGCTCAATATCGCTGTCCAGTTCAAGCCAACTCGCTGACTGGCCTCGCTGTCCCC TCTGCAAACCCGAAGGTCTTTCGTACCCAATCCCGCACTTTCATAACGGAAGACGGCTTCCCTCAGCCCATCGAG TTCTTCATCGCGTCTGACGCAGCGGCTATAATTGAGCACACTAAACGTGTTCTCTACCTCGAAGATGACGATATC GCTCACATTGCTGATGGTGAATTACAAATTCATCGTCTCCGTCGTAAGGAGGAAGGGCATCAGACACCCAGTCAA ATTGCCACCACACGCACCATCGAGACTCTCGAGCTAGAAATTGCGGCCATCATGAAGGGCAAGTTCGATACTTTC ATGCAAAAAGAAATTTATGAACAGCCGGAATCGGTCGTCAACACTATGCGAGGTCGTGTTAACTTCGACGAACAA AGAATTACCCTTGGTGGCCTGCGCGCGTATCTTCCCATCATGCGTCGCAGCAGGCGTATTGTTTTCATTGCCTGT GGCACCAGTTACCATTCATGCTTGGCTACCCGTGCGATCTTCGAGGAATTAACCGAAATCCCGGTTGGTGTTGAA TTGGCTAGCGATTTCTTGGATCGGAAGACTCCTATTTTCCGTGACGACGTGTGCGTCTTCCTAAGCCAGAGTGGA GAGACTGCAGATACCATCCTGGCCATGCGTTATTGCATGGATCGTGGTGCCCTTTGTGTCGGTGTTGTCAATACT GTTGGTTCCACCATCTCTCGTGAGACCCATTGCGGTGTCCACATCAACGCTGGTCCCGAAGTCGGTGTCGCTTCT ACTAAGGTTAGTCATTCATTGTTAACCTGAGGATTTTCTCTCATAATTCCCTCTAGGCCTACACCTCCCAATACG TTGCTCTCATGATGATTGCGCTACAACTTTCCGAGGATCGTATCTCCTTCACCGAACGAAGGAACCAAATTATCA ATGGTCTCCACTCTCTTTCTGCTCAAATTACGAAGGTCCTTGAGCTCGACCCCATTCTCGAAGAACTTGCGGAAG GCATTCACAAGAATAAGAGTCTGCTGATAATGGGTCGTGGAATGCAGTACGTATCATTCTCAACGTTATGGACTC ATCTAATGTCACCCTTAGGCATGCTACGTGTTTGGAGGGCGCCCTCAAAATCAAGGAGATCAGTTACATGCACTC CGAAGGTATTCTTGCTGGAGAGCTCAAGCATGGTCCCCTTGCTCTCATCGACGAGAACATGCCGGTTATTATAAT CATGACCCGAGACTCGTTATATCCCAAGGTCCAGTCCGCCTTTGCCCAGATCACCGCTCGCAAGGCTCGGCCCAT TGTCCTTTGTAACGAGGGTGATGATGGTATCCCCGCCAACGCCACTACCATTCGCGTCCCTCAGACCGTCGATTC CCTTCAAGGACTTCTCAACATCATTCCTTTGCAACTCTTGAGTTACCACCTCGCTGTCAAGAACGGTTGCGACGT TGATTTCCCCCGTAACTTGTACGTGCATCATATGTCTCTTAGCTATAACTACTAATGATCCTATAGGGCCAAATC GGTCACTGTTGAGTAA |