Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|109130
Gene name
Locationscaffold_8:722418..723497
Strand-
Gene length (bp)1079
Transcript length (bp)876
Coding sequence length (bp)876
Protein length (aa) 292

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05018 CFA20_dom CFA20 domain 2.2E-14 81 156

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A8IU92|CFA20_CHLRE Cilia- and flagella-associated protein 20 OS=Chlamydomonas reinhardtii GN=CFAP20 PE=1 SV=1 1 156 5.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|109130
MFDNLLQPSSISLFSSTGSEPLQLWAVETDASNQSCVRLLHDSASQSLHSESASLISPPPLVELGGAERGSEIDS
QNLGYNLNQTVLHIQSPKLPTTYIQCPPNRNHSSLGLKHPWMHLQVRNLGRDWSFEVGLVDHSGRIGVLRMSTFQ
KQPRLKLSRGAENSLPLLHLPLSFPSRSSRPLTAWTTINLHLPTFIPYFSQSNLLTKGEEDQDQEPKDESHLGPE
YQSWEHGQSLRQTSNIPSGSYSHISYIRVYATCRLRRIWMLLLHFALYGDLDFGNLSVNQNEFNPQ*
Coding >AgabiH97|109130
ATGTTCGACAATCTACTTCAACCCTCCTCAATTTCATTGTTCTCGTCCACCGGTTCTGAACCATTGCAGCTATGG
GCCGTTGAAACAGATGCCTCGAACCAAAGCTGTGTCCGCTTACTGCATGACTCGGCTTCTCAGTCGCTTCACTCC
GAGAGCGCTTCTTTGATATCACCTCCTCCTTTGGTAGAACTTGGAGGGGCAGAAAGGGGATCAGAAATCGATTCA
CAAAATCTAGGCTACAATTTGAATCAGACTGTACTCCATATCCAGTCTCCAAAGCTACCAACTACATATATTCAA
TGTCCGCCAAATAGGAATCACTCGTCGCTTGGACTAAAACACCCATGGATGCATTTACAAGTCCGAAATTTGGGT
AGAGATTGGTCCTTTGAAGTAGGACTAGTCGATCATTCTGGAAGAATAGGGGTACTCCGAATGTCAACATTCCAG
AAACAACCGAGACTCAAGCTCAGTCGAGGTGCCGAAAATTCTCTACCGTTGCTTCACCTACCACTATCCTTCCCA
TCTCGATCATCTCGACCACTCACGGCTTGGACAACTATTAATCTTCATCTTCCGACATTCATTCCATATTTCTCC
CAGTCTAATCTTCTTACGAAGGGTGAGGAAGATCAAGACCAAGAACCAAAAGACGAAAGTCATCTAGGACCTGAA
TATCAATCTTGGGAGCACGGACAGAGTCTTCGTCAGACGAGTAATATTCCTTCCGGATCATACTCGCACATCTCA
TATATTCGAGTATACGCGACTTGTCGATTGAGGAGGATTTGGATGCTGCTGCTACATTTTGCGCTATATGGTGAC
TTAGACTTTGGTAATCTCTCGGTCAATCAAAACGAATTCAATCCTCAATAG
Transcript >AgabiH97|109130
ATGTTCGACAATCTACTTCAACCCTCCTCAATTTCATTGTTCTCGTCCACCGGTTCTGAACCATTGCAGCTATGG
GCCGTTGAAACAGATGCCTCGAACCAAAGCTGTGTCCGCTTACTGCATGACTCGGCTTCTCAGTCGCTTCACTCC
GAGAGCGCTTCTTTGATATCACCTCCTCCTTTGGTAGAACTTGGAGGGGCAGAAAGGGGATCAGAAATCGATTCA
CAAAATCTAGGCTACAATTTGAATCAGACTGTACTCCATATCCAGTCTCCAAAGCTACCAACTACATATATTCAA
TGTCCGCCAAATAGGAATCACTCGTCGCTTGGACTAAAACACCCATGGATGCATTTACAAGTCCGAAATTTGGGT
AGAGATTGGTCCTTTGAAGTAGGACTAGTCGATCATTCTGGAAGAATAGGGGTACTCCGAATGTCAACATTCCAG
AAACAACCGAGACTCAAGCTCAGTCGAGGTGCCGAAAATTCTCTACCGTTGCTTCACCTACCACTATCCTTCCCA
TCTCGATCATCTCGACCACTCACGGCTTGGACAACTATTAATCTTCATCTTCCGACATTCATTCCATATTTCTCC
CAGTCTAATCTTCTTACGAAGGGTGAGGAAGATCAAGACCAAGAACCAAAAGACGAAAGTCATCTAGGACCTGAA
TATCAATCTTGGGAGCACGGACAGAGTCTTCGTCAGACGAGTAATATTCCTTCCGGATCATACTCGCACATCTCA
TATATTCGAGTATACGCGACTTGTCGATTGAGGAGGATTTGGATGCTGCTGCTACATTTTGCGCTATATGGTGAC
TTAGACTTTGGTAATCTCTCGGTCAATCAAAACGAATTCAATCCTCAATAG
Gene >AgabiH97|109130
ATGTTCGACAATCTACTTCAACCCTCCTCAATTTCATTGTTCTCGTCCACCGGTTCTGAACCATTGCAGCTATGG
GCCGTTGAAACAGATGCCTCGAACCAAAGCTGTGTCCGCTTACTGCATGACTCGGCTTCTCAGTCGCTTCACTCC
GAGAGCGCTTCTTTGATATCACCTCCTCCTTTGGTAGAACTTGGAGGGGCAGAAAGGGGATCAGAAATCGATTCA
CAAAATCTAGGCTACAATTTGAATCAGACTGTACTCCATATCCAGTCTCCAAAGCTACCAACTACATATATTCAA
TGTCCGCCAAATAGGAATCACTCGTCGCTTGGACTAAAACACCCATGGATGCATTTACAAGTCCGAAATTTGGGT
AGAGATTGGTCCTTTGAAGTAGGACTAGTCGATCATTCTGGAAGAATAGGGGTACTCCGAATGTCAACATTCCAG
GTATATACCAATTATTATTCGATCTCGATTTTCGATTGGAAACATACTACATATCTTGGTCTTTATTTTTATAAC
TTGATGGTTAATCGTATCCTTTGACAGAAACAACCGAGACTCAAGCTCAGTCGAGGTGCCGAAAATTCTCTACCG
TTGCTTCACCTACCACTATCCTTCCCATCTCGATCATCTCGACCACTCACGGCTTGGACAACTATTAATCTTCAT
CTTCCGACATTCATTCCATATTTCTCCCAGTCTAATCTTCTTACGAAGGGTGAGGAAGATCAAGACCAAGAACCA
AAAGACGAAAGTCATCTAGGACCTGAATATCAATCTTGGGAGCACGGACAGAGTCTTCGTCAGACGAGTAATATT
CCTTCCGGATCATACTCGCACATCTCATATATTCGAGTATACGCGACTTGTCGATTGAGGAGGATTTGGTTTGAT
GAGAATGGTCGTCCACCTTGGGAATTTGAGCTTTATTCTGCTGACTAGGATGCTGCTGCTACATTTGTGAGTCTC
CGAATCCAAACATGTTGACCTATCGCTGACTTATCAGTGCGCTATATGGTGACTTAGACTTTGGTAATCTCTCGG
TCAATCAAAACGAATTCAATCCTCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail