Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|109020
Gene name
Locationscaffold_8:699417..701134
Strand-
Gene length (bp)1717
Transcript length (bp)1116
Coding sequence length (bp)1116
Protein length (aa) 372

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 1.8E-41 99 279

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32623|CRH2_YEAST Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTR2 PE=1 SV=3 13 355 5.0E-76
sp|Q4WI46|CRF2_ASPFU Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=1 20 344 5.0E-76
sp|Q5AJC0|UTR2_CANAL Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTR2 PE=1 SV=1 14 344 1.0E-66
sp|Q05790|CRR1_YEAST Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRR1 PE=2 SV=1 17 305 2.0E-46
sp|Q75A41|CRR1_ASHGO Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CRR1 PE=3 SV=1 29 305 6.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32623|CRH2_YEAST Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTR2 PE=1 SV=3 13 355 5.0E-76
sp|Q4WI46|CRF2_ASPFU Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=1 20 344 5.0E-76
sp|Q5AJC0|UTR2_CANAL Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTR2 PE=1 SV=1 14 344 1.0E-66
sp|Q05790|CRR1_YEAST Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRR1 PE=2 SV=1 17 305 2.0E-46
sp|Q75A41|CRR1_ASHGO Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CRR1 PE=3 SV=1 29 305 6.0E-45
sp|Q8J0P4|CRF1_ASPFU Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=2 58 326 2.0E-24
sp|D4B4J2|CRH12_ARTBC Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03382 PE=3 SV=2 134 290 3.0E-23
sp|Q5AFA2|CRH11_CANAL Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH11 PE=1 SV=1 58 286 2.0E-20
sp|P53301|CRH1_YEAST Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRH1 PE=1 SV=1 121 287 4.0E-19
sp|D4ALQ5|CRH11_ARTBC Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05253 PE=1 SV=2 123 286 1.0E-18
sp|Q84C00|GUB_CLOTM Beta-glucanase OS=Clostridium thermocellum GN=licB PE=1 SV=1 117 271 3.0E-13
sp|A3DBX3|GUB_CLOTH Beta-glucanase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=licB PE=1 SV=1 117 270 6.0E-13
sp|Q5AK54|CRH12_CANAL Extracellular glycosidase CRH12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH12 PE=1 SV=1 121 306 8.0E-13
sp|Q8LF99|XTH6_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 6 OS=Arabidopsis thaliana GN=XTH6 PE=2 SV=2 119 314 1.0E-11
sp|Q9ZSU4|XTH14_ARATH Xyloglucan endotransglucosylase/hydrolase protein 14 OS=Arabidopsis thaliana GN=XTH14 PE=1 SV=1 104 293 4.0E-11
sp|P27051|GUB_BACLI Beta-glucanase OS=Bacillus licheniformis GN=bg1 PE=1 SV=1 85 270 5.0E-11
sp|Q38911|XTH15_ARATH Xyloglucan endotransglucosylase/hydrolase protein 15 OS=Arabidopsis thaliana GN=XTH15 PE=1 SV=1 101 317 7.0E-11
sp|P04957|GUB_BACSU Beta-glucanase OS=Bacillus subtilis (strain 168) GN=bglS PE=1 SV=2 85 275 8.0E-11
sp|P07980|GUB_BACAM Beta-glucanase OS=Bacillus amyloliquefaciens GN=bglA PE=3 SV=1 85 270 1.0E-10
sp|P23904|GUB_PAEMA Beta-glucanase OS=Paenibacillus macerans PE=1 SV=2 104 270 2.0E-10
sp|Q9FKL9|XTH12_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 12 OS=Arabidopsis thaliana GN=XTH12 PE=2 SV=1 104 293 2.0E-10
sp|Q9FKL8|XTH13_ARATH Putative xyloglucan endotransglucosylase/hydrolase protein 13 OS=Arabidopsis thaliana GN=XTH13 PE=3 SV=1 104 293 6.0E-10
sp|P35694|XTH2_SOYBN Xyloglucan endotransglucosylase/hydrolase 2 OS=Glycine max PE=2 SV=1 104 304 7.0E-10
sp|Q8LG58|XTH16_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 16 OS=Arabidopsis thaliana GN=XTH16 PE=2 SV=2 100 314 1.0E-09
sp|P45797|GUB_PAEPO Beta-glucanase OS=Paenibacillus polymyxa GN=gluB PE=3 SV=1 85 264 2.0E-09
sp|Q53317|XYND_RUMFL Xylanase/beta-glucanase OS=Ruminococcus flavefaciens GN=xynD PE=3 SV=2 131 270 6.0E-09
sp|Q9ZVK1|XTH10_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 10 OS=Arabidopsis thaliana GN=XTH10 PE=2 SV=1 112 264 9.0E-09
sp|P37073|GUB_BREBE Beta-glucanase OS=Brevibacillus brevis GN=bglBB PE=1 SV=1 116 266 2.0E-08
sp|Q39099|XTH4_ARATH Xyloglucan endotransglucosylase/hydrolase protein 4 OS=Arabidopsis thaliana GN=XTH4 PE=1 SV=1 118 272 4.0E-08
sp|Q8L9A9|XTH8_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 8 OS=Arabidopsis thaliana GN=XTH8 PE=2 SV=2 72 272 7.0E-08
sp|Q38907|XTH25_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 25 OS=Arabidopsis thaliana GN=XTH25 PE=2 SV=2 100 293 7.0E-08
sp|Q38910|XTH23_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 23 OS=Arabidopsis thaliana GN=XTH23 PE=2 SV=1 101 293 1.0E-07
sp|Q38857|XTH22_ARATH Xyloglucan endotransglucosylase/hydrolase protein 22 OS=Arabidopsis thaliana GN=XTH22 PE=1 SV=1 101 293 1.0E-07
sp|Q6YDN9|XTH_BRAOB Xyloglucan endotransglucosylase/hydrolase OS=Brassica oleracea var. botrytis GN=XET16A PE=1 SV=1 118 272 2.0E-07
sp|P93349|XTH_TOBAC Probable xyloglucan endotransglucosylase/hydrolase protein OS=Nicotiana tabacum GN=XTH PE=2 SV=1 117 305 2.0E-07
sp|O14412|GUB_ORPSP Beta-glucanase OS=Orpinomyces sp. (strain PC-2) GN=licA PE=1 SV=1 113 270 6.0E-07
sp|Q9XIW1|XTH5_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 5 OS=Arabidopsis thaliana GN=XTH5 PE=2 SV=1 118 272 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 351 370 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|109020
MHRHTGVLIIPVLLTWLAGIATAASGTTCNATTLCPASAPCCSEFGFCGDDSFCLGGCNPFASHSVDSCRPSPIC
EDATFTFPDNSRILSNADYFEGNASEYDWVVNKGNIMNTNSSGGELVLTLTEENGGTRLSSTRYVYYGTISAKLK
TGKWGGVVTAFITMSDIKDEIDWEFPGTHTTQGQTNYFWQGVIPTDKTNGKTTTESLSDTFSNYHTYTIDWQQDQ
LKFLIDGKNQQTVKKSDTIDSNGVAHYPSTPSRIQLSLWPAGTDDQAPGTVQWAGGMIDWNDPDYKAAGHFYATV
QSVEVKCAPVLKPSPNDTSYLYSNSSDHSSPTITLSNHSTLLNSAPIDGVSGMHGMVVGLIALFLAFVHLF*
Coding >AgabiH97|109020
ATGCACCGACACACAGGCGTTTTGATAATTCCTGTTCTCCTCACATGGCTGGCCGGAATTGCAACCGCAGCCTCA
GGTACCACCTGCAACGCCACTACATTATGCCCTGCTTCTGCGCCTTGTTGCAGTGAATTTGGATTTTGTGGAGAC
GACAGTTTTTGTTTGGGTGGCTGTAACCCTTTTGCTTCTCACTCCGTCGACTCGTGCCGTCCTAGCCCGATCTGC
GAGGATGCCACATTTACTTTCCCTGACAACTCTCGTATCCTTTCCAATGCTGACTACTTTGAAGGAAACGCCTCA
GAGTACGATTGGGTTGTCAATAAAGGAAATATCATGAACACCAATTCAAGTGGAGGCGAGCTTGTCCTGACGCTC
ACAGAGGAGAATGGAGGAACAAGGCTTTCTTCCACCAGATATGTTTATTATGGCACCATAAGTGCTAAACTGAAG
ACCGGTAAATGGGGAGGCGTAGTCACGGCGTTTATCACTATGAGTGATATCAAAGACGAAATCGATTGGGAGTTT
CCTGGTACCCATACTACTCAAGGACAAACGAACTATTTCTGGCAGGGTGTTATTCCTACGGACAAAACAAATGGG
AAAACGACTACGGAATCTCTTTCGGACACATTCAGCAATTACCATACATACACCATCGATTGGCAACAGGACCAA
TTGAAGTTTTTGATTGATGGGAAGAATCAACAGACCGTCAAGAAGTCCGACACTATTGATTCTAATGGTGTTGCT
CACTACCCGAGTACTCCGTCCCGCATTCAGCTTTCCTTGTGGCCTGCCGGCACCGACGACCAAGCACCTGGAACC
GTTCAGTGGGCCGGAGGTATGATCGATTGGAACGACCCCGACTATAAGGCTGCAGGCCATTTCTATGCCACTGTT
CAATCTGTTGAAGTCAAATGTGCCCCCGTCCTAAAACCCAGCCCCAACGATACTTCATACTTATATTCCAATTCT
TCCGATCATTCTTCACCTACGATTACCCTCAGTAATCATTCAACTTTGTTGAATTCCGCTCCAATTGATGGCGTG
TCTGGTATGCATGGTATGGTGGTTGGATTGATTGCTTTGTTCCTCGCATTTGTACACTTGTTTTGA
Transcript >AgabiH97|109020
ATGCACCGACACACAGGCGTTTTGATAATTCCTGTTCTCCTCACATGGCTGGCCGGAATTGCAACCGCAGCCTCA
GGTACCACCTGCAACGCCACTACATTATGCCCTGCTTCTGCGCCTTGTTGCAGTGAATTTGGATTTTGTGGAGAC
GACAGTTTTTGTTTGGGTGGCTGTAACCCTTTTGCTTCTCACTCCGTCGACTCGTGCCGTCCTAGCCCGATCTGC
GAGGATGCCACATTTACTTTCCCTGACAACTCTCGTATCCTTTCCAATGCTGACTACTTTGAAGGAAACGCCTCA
GAGTACGATTGGGTTGTCAATAAAGGAAATATCATGAACACCAATTCAAGTGGAGGCGAGCTTGTCCTGACGCTC
ACAGAGGAGAATGGAGGAACAAGGCTTTCTTCCACCAGATATGTTTATTATGGCACCATAAGTGCTAAACTGAAG
ACCGGTAAATGGGGAGGCGTAGTCACGGCGTTTATCACTATGAGTGATATCAAAGACGAAATCGATTGGGAGTTT
CCTGGTACCCATACTACTCAAGGACAAACGAACTATTTCTGGCAGGGTGTTATTCCTACGGACAAAACAAATGGG
AAAACGACTACGGAATCTCTTTCGGACACATTCAGCAATTACCATACATACACCATCGATTGGCAACAGGACCAA
TTGAAGTTTTTGATTGATGGGAAGAATCAACAGACCGTCAAGAAGTCCGACACTATTGATTCTAATGGTGTTGCT
CACTACCCGAGTACTCCGTCCCGCATTCAGCTTTCCTTGTGGCCTGCCGGCACCGACGACCAAGCACCTGGAACC
GTTCAGTGGGCCGGAGGTATGATCGATTGGAACGACCCCGACTATAAGGCTGCAGGCCATTTCTATGCCACTGTT
CAATCTGTTGAAGTCAAATGTGCCCCCGTCCTAAAACCCAGCCCCAACGATACTTCATACTTATATTCCAATTCT
TCCGATCATTCTTCACCTACGATTACCCTCAGTAATCATTCAACTTTGTTGAATTCCGCTCCAATTGATGGCGTG
TCTGGTATGCATGGTATGGTGGTTGGATTGATTGCTTTGTTCCTCGCATTTGTACACTTGTTTTGA
Gene >AgabiH97|109020
ATGCACCGACACACAGGCGTTTTGATAATTCCTGTTCTCCTCACATGGCTGGCCGGAATTGCAACCGCAGCCTCA
GGTACCACCTGGTTGGCACTTTTCCCGTTACTATTGCAGAAACCAAGGACTAAGGATGAATCTAGCAACGCCACT
ACATTATGCCCTGCTTCTGCGCCTTGTTGCAGTACGTCCAAATTCTGCAGTCGTGCTCTATTAATAAAATTTGAT
ATCGATCTCAAGGTGAATTTGGATTTTGTGGAGACGACAGTGTAAGCAACTTCGGAAGCCTAATCTCTTACGATA
TGTGGAGACTGATTGAGCCGCCCACTTGATTGACTATCAGTTTTGTTTGGGTGGCTGTAACCCTTTTGCTTCTCA
CTCCGTCGACTCGTGCCGTCCTAGCCCGATCTGCGAGGATGCCACAGTATGTACCTCATTTCTCTGTCAAATAGT
TCTATCTGACAGCATTCTAGTTTACTTTCCCTGACAACTCTCGTATCCTTTCCAATGCTGACTACTTTGAAGGAA
ACGCCTCAGAGTACGGTAAGCGCTGTTTTTTTTGCGTCTCGAGTCTGGGTTGGAATCTGATGTTGGGTTGGGGTG
GGATCTCATTAGATTGGGTTGTCAATAAAGGAAATATCATGAACACCAATTCAAGTGGAGGCGAGCTTGTCCTGA
CGCTCACAGAGGAGAATGGAGGAACAAGGCTTTCTTCCACCAGATATGTTTATTATGGCACCATAAGTGCTAAAC
GTACGTCAATCTCATTCCCCAACTCTGTCAACGTTTCCTGATGCCAATTAATCTGTAGTGAAGACCGGTAAATGG
GGAGGCGTAGTCACGGCGTTTATCACTATGAGTGATATCAAAGACGAAATCGATTGGGAGTTTCCTGGTACCCAT
ACTACTCAAGGACAAACGAACTATTTCTGGCAGGGTGTTATTCGTACGTTGTCTTTTCTTGTTGTCTCCCCAAAA
AAGGCGTAATAAGGGACACCCTATAGCTACGGACAAAACAAATGGGAAAACGACTACGGAATCTCTTTCGGACAC
ATTCAGCAATTACCATACATACACCGTGAATACCTTACATCATCATTGACGCCAGTCCGAGCGACTAACTTGCTT
TGTAAAGATCGATTGGCAACAGGACCAATTGAAGTTTTTGATTGATGGGAAGAATCAACAGACCGTCAAGAAGTC
CGACACTATTGATTCTAATGGTGTTGCTCACTACCCGAGTACTCCGTCCCGCATTCAGCTTTCGTGAGCCATTAA
CTTTTGATATACCCTGACTAGACTGTCGAACACTATTGTATCTTGCAGCTTGTGGCCTGCCGGCACCGACGACCA
AGCACCTGGAACCGTTCAGTGGGCCGGAGGTATGATCGATTGGAACGACCCCGACTATAAGGCTGCAGGTACGTC
AACAGTATAATACGGTTCAGCTCCGTTCTTTTACTCACATGGACAAACTCGTTCAGGCCATTTCTATGCCACTGT
TCAATCTGTTGAAGTCAAATGTGCCCCCGTCCTAAAACCCAGCCCCAACGATACTTCATACTTATATTCCAATTC
TTCCGATCATTCTTCACCTACGATTACCCTCAGTAATCATTCAACTTTGTTGAATTCCGCTCCAATTGATGGCGT
GTCTGGTATGCATGGTATGGTGGTTGGATTGATTGCTTTGTTCCTCGCATTTGTACACTTGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail