Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|108540
Gene name
Locationscaffold_8:581289..583277
Strand+
Gene length (bp)1988
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.1E-15 66 315

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08280|BSC6_YEAST Bypass of stop codon protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BSC6 PE=1 SV=1 41 443 2.0E-28
sp|O07563|GLCP_BACSU Glucose/mannose transporter GlcP OS=Bacillus subtilis (strain 168) GN=glcP PE=1 SV=1 79 413 7.0E-14

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 61 79 18
2 94 116 22
3 123 142 19
4 152 174 22
5 187 209 22
6 214 236 22
7 272 294 22
8 304 326 22
9 333 355 22
10 360 382 22
11 389 411 22
12 421 443 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|108540
MSEERDNVGKIEVISKTAGSNGMIVTNHAMTVDDGKIEELEIADTSKLDIRTKKQKSTERIHCSALCLGNFIFGW
NDGSTGPLLPRIQETYDVGFTVVSLIFIFACVGIICGALVNVYLTDRLGFGRIIALGAALQVIAYALESSGSPFP
VFVMAFAINGCGNGLQGAQANAFIASLKHNSEAKMGLLHAAYGAGALTAPLIATQFAQLPRWSFHYLVSVGIAFC
NVILLLVVFRFKTREECFSMFGQKATESGEDEQSSLKRILRAKSVHFLAFFVLAYVGVEVTIGGWIVTFMLNVRG
GGPSAGYISSGFFGGLMLGRVLLLWVNKKLGERLAIYLYTLLCIGLEIVVWLAPSLIGGAVAVSFVGLFLGPMFP
IAMIHAGRILPKWLLTGSIGWIAGFGSAGSAAVPFLTGAISSKHGIQSLQPLLIAMMGCMLVLWYIVPSNSKRSD
*
Coding >AgabiH97|108540
ATGTCTGAAGAGCGCGACAATGTCGGAAAAATTGAAGTCATTTCAAAGACAGCCGGTTCAAACGGGATGATTGTC
ACCAATCATGCGATGACCGTGGACGACGGGAAAATAGAAGAACTAGAGATAGCAGATACAAGTAAGCTGGATATC
AGGACCAAGAAGCAGAAATCAACAGAAAGGATTCACTGCTCGGCGTTGTGTTTGGGCAACTTCATATTCGGATGG
AATGATGGTTCTACTGGGCCTTTGCTACCTCGTATACAGGAAACCTATGACGTTGGTTTTACTGTTGTATCTCTG
ATTTTCATTTTCGCCTGCGTTGGAATCATTTGCGGTGCTCTCGTCAACGTTTATCTAACAGATCGTCTTGGATTC
GGCAGGATTATCGCGCTTGGCGCTGCTCTACAAGTCATAGCGTATGCTCTTGAATCATCGGGATCTCCCTTTCCT
GTATTCGTCATGGCTTTCGCTATCAATGGCTGTGGCAACGGCCTTCAGGGAGCACAAGCTAACGCTTTCATTGCG
AGCCTTAAACATAACTCAGAAGCGAAAATGGGTCTTCTTCACGCTGCTTATGGTGCTGGAGCTCTCACTGCACCA
CTCATCGCTACACAGTTTGCGCAACTTCCACGCTGGTCTTTTCATTACTTGGTATCTGTCGGAATTGCCTTTTGC
AATGTGATTCTCCTCCTAGTTGTGTTCAGGTTTAAAACTCGAGAAGAATGTTTTAGCATGTTTGGACAAAAAGCC
ACGGAAAGCGGCGAGGACGAACAATCTTCCTTGAAACGGATCCTTCGTGCCAAATCTGTCCACTTCCTGGCCTTC
TTTGTTCTTGCCTATGTTGGCGTTGAGGTTACGATTGGAGGCTGGATCGTCACCTTTATGCTTAACGTTCGCGGT
GGTGGGCCATCCGCCGGTTATATTTCGTCAGGTTTCTTCGGCGGTCTTATGCTCGGCCGTGTTCTCCTACTCTGG
GTTAACAAAAAGCTTGGTGAACGCCTCGCAATCTATCTCTACACTTTGCTCTGTATAGGGCTCGAAATCGTCGTT
TGGCTTGCCCCTTCGCTCATTGGCGGAGCTGTAGCAGTGTCCTTCGTCGGTTTATTCCTTGGACCCATGTTCCCA
ATCGCAATGATACACGCTGGGCGAATTCTTCCGAAATGGTTACTCACTGGATCAATTGGTTGGATAGCTGGATTT
GGTTCAGCGGGGAGCGCTGCGGTTCCTTTCCTCACCGGTGCGATCTCTTCTAAGCATGGGATACAGAGTCTGCAA
CCTTTATTGATTGCGATGATGGGTTGTATGTTGGTTTTGTGGTACATTGTACCCTCAAACTCCAAACGAAGTGAT
TAG
Transcript >AgabiH97|108540
ATGTCTGAAGAGCGCGACAATGTCGGAAAAATTGAAGTCATTTCAAAGACAGCCGGTTCAAACGGGATGATTGTC
ACCAATCATGCGATGACCGTGGACGACGGGAAAATAGAAGAACTAGAGATAGCAGATACAAGTAAGCTGGATATC
AGGACCAAGAAGCAGAAATCAACAGAAAGGATTCACTGCTCGGCGTTGTGTTTGGGCAACTTCATATTCGGATGG
AATGATGGTTCTACTGGGCCTTTGCTACCTCGTATACAGGAAACCTATGACGTTGGTTTTACTGTTGTATCTCTG
ATTTTCATTTTCGCCTGCGTTGGAATCATTTGCGGTGCTCTCGTCAACGTTTATCTAACAGATCGTCTTGGATTC
GGCAGGATTATCGCGCTTGGCGCTGCTCTACAAGTCATAGCGTATGCTCTTGAATCATCGGGATCTCCCTTTCCT
GTATTCGTCATGGCTTTCGCTATCAATGGCTGTGGCAACGGCCTTCAGGGAGCACAAGCTAACGCTTTCATTGCG
AGCCTTAAACATAACTCAGAAGCGAAAATGGGTCTTCTTCACGCTGCTTATGGTGCTGGAGCTCTCACTGCACCA
CTCATCGCTACACAGTTTGCGCAACTTCCACGCTGGTCTTTTCATTACTTGGTATCTGTCGGAATTGCCTTTTGC
AATGTGATTCTCCTCCTAGTTGTGTTCAGGTTTAAAACTCGAGAAGAATGTTTTAGCATGTTTGGACAAAAAGCC
ACGGAAAGCGGCGAGGACGAACAATCTTCCTTGAAACGGATCCTTCGTGCCAAATCTGTCCACTTCCTGGCCTTC
TTTGTTCTTGCCTATGTTGGCGTTGAGGTTACGATTGGAGGCTGGATCGTCACCTTTATGCTTAACGTTCGCGGT
GGTGGGCCATCCGCCGGTTATATTTCGTCAGGTTTCTTCGGCGGTCTTATGCTCGGCCGTGTTCTCCTACTCTGG
GTTAACAAAAAGCTTGGTGAACGCCTCGCAATCTATCTCTACACTTTGCTCTGTATAGGGCTCGAAATCGTCGTT
TGGCTTGCCCCTTCGCTCATTGGCGGAGCTGTAGCAGTGTCCTTCGTCGGTTTATTCCTTGGACCCATGTTCCCA
ATCGCAATGATACACGCTGGGCGAATTCTTCCGAAATGGTTACTCACTGGATCAATTGGTTGGATAGCTGGATTT
GGTTCAGCGGGGAGCGCTGCGGTTCCTTTCCTCACCGGTGCGATCTCTTCTAAGCATGGGATACAGAGTCTGCAA
CCTTTATTGATTGCGATGATGGGTTGTATGTTGGTTTTGTGGTACATTGTACCCTCAAACTCCAAACGAAGTGAT
TAG
Gene >AgabiH97|108540
ATGTCTGAAGAGCGCGACAATGTCGGAAAAATTGAAGTCATTTCAAAGACAGCCGGTTCAAACGGGATGATTGTC
ACCAATCATGCGATGACCGTGGACGACGGGAAAATAGAAGAACTAGAGATAGCAGATACAAGTAAGCTGGATATC
AGGACCAAGAAGCAGAAATCAACAGAAAGGATTCACTGCTCGGCGTTGTGTTTGGGCAACTTCATATTCGGATGG
AATGATGGTTCTACTGGGCCTTTGCTACCTCGTATACAGGAAACCTATGACGTACATTTTATTCCGCTTTACCAT
CGGCTTTCAATTCAGGAATACTTATAATCAGGTTGGTTTTACTGTTGTATCTCTGATTTTCATTTTCGCCTGCGT
TGTAAGTCCCCTGTTGGCCTTGTTTCGTTTCCATGACTGACACTGCACATTTTCAACAAAGGGAATCATTTGCGG
TGCTCTCGTCAACGTTTATCTAACAGATCGTCTTGGATTCGGCAGGGCATGTATATTCTAGAATATTCGTCCAAC
AAGAGTTACTTACAATTGCATGGCGGCTAGATTATCGCGCTTGGTACATGACATTGTTTCTCTTTTCATCCCTGT
GACTAACATCAAGAAACCCAGGCGCTGCTCTACAAGTCATAGCGTATGCTCTTGAATCATCGGGATCTCCCTTTC
CTGTATTCGTCATGGCTTTCGCTATCAATGGCTGTGGCAACGGCCTTCAGGTTCGCCGCATATCCTTGTCCATCC
TATATCGATGATCACGACATTACAGGGAGCACAAGCTAACGCTTTCATTGCGAGCCTTAAACATAACTCAGAAGC
GAAAATGGGTCTTCTTCACGCTGCTTATGGTTGCGTTACACTCGTTCTTTCATCGCTCTAGCTAATTCTTCCCAG
GTGCTGGAGCTCTCACTGCACCACTCATCGCTACACAGTTTGCGCAACTTCCACGCTGGTCTTTTCATTACTTGG
TATCTGTCGGAATTGCCTTTTGCAATGTGATTCTCCTCCTAGTTGTGTTCAGGTTTAAAACTCGAGAAGGTCAGA
TTCGAATCATTCCCAGACCTTGTCTTATTCATACATTTCATCAGAATGTTTTAGCATGTTTGGACAAAAAGCCAC
GGAAAGCGGCGAGGACGAACAATCTTCCTTGAAACGGATCCTTCGTGCCAAATCTGTCCACTTCCTGGCCTTCTT
TGTTCTTGCCTATGTTGGCGTTGAGGTTACGATTGGAGGTTAGTTTCTATTTCCACGAAGGAAAGCTCAATATTG
ATATTACTAGGCTGGATCGTCACCTTTATGCTTAACGTTCGCGGTGGTGGGCCATCCGCCGGTTATATTTCGTCA
GGTTTCTTCGGCGGTAGGTTATATCTCATCTAGTGAAATAATGAGAGACATCTAATGCAAATTACAAGGTCTTAT
GCTCGGCCGTGTTCTCCTACTCTGGGTTAACAAAAAGGTGCCACGCTTCCACACCGAGTCTTGCGCCATCCTAAT
CAAATACCTAGCTTGGTGAACGCCTCGCAATCTATCTCTACACTTTGCTCTGTATAGGGTAAGTTTCTTCTCTCT
GATATAGTCTAAATTCCTAGAATTATATAGGCTCGAAATCGTCGTTTGGCTTGCCCCTTCGCTCATTGGCGGAGC
TGTAGCAGTGTCCTTCGTCGGTTTATTCCTTGGACCCATGTTCCCAATCGCAATGATACACGCTGGGCGAATTCT
TCCGAAATGGTTACTCACTGGATCAATTGGTTGGATAGCTGGATTTGGTTCAGCGGGGAGCGCTGCGGTTCCTTT
CCTCACCGGTGCGATCTCTTCTAAGCATGGGATACAGAGTCTGCAACCTTTGTGAGTGTACTTTATTTTCCACTA
GTGGAATAAGCAAGCCGCTTAATTTTTCGTTTTATTCTAGATTGATTGCGATGATGGGTTGTATGTTGGTTTTGT
GGTACATTGTACCCTCAAACTCCAAACGAAGTGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail