Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|108530
Gene name
Locationscaffold_8:578937..580018
Strand-
Gene length (bp)1081
Transcript length (bp)693
Coding sequence length (bp)693
Protein length (aa) 231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25 1.4E-52 28 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4ANU4|LYS_ARTBC N,O-diacetylmuramidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05911 PE=1 SV=1 18 229 1.0E-78
sp|P00721|LYS_CHASP N,O-diacetylmuramidase OS=Chalaropsis sp. PE=1 SV=1 26 229 6.0E-67
sp|P25310|LYSM1_STRGL Lysozyme M1 OS=Streptomyces globisporus GN=acm PE=1 SV=1 26 227 2.0E-66
sp|Q8FFY2|YEGX_ECOL6 Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yegX PE=3 SV=2 1 229 1.0E-18
sp|P76421|YEGX_ECOLI Uncharacterized protein YegX OS=Escherichia coli (strain K12) GN=yegX PE=3 SV=2 1 229 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4ANU4|LYS_ARTBC N,O-diacetylmuramidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05911 PE=1 SV=1 18 229 1.0E-78
sp|P00721|LYS_CHASP N,O-diacetylmuramidase OS=Chalaropsis sp. PE=1 SV=1 26 229 6.0E-67
sp|P25310|LYSM1_STRGL Lysozyme M1 OS=Streptomyces globisporus GN=acm PE=1 SV=1 26 227 2.0E-66
sp|Q8FFY2|YEGX_ECOL6 Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yegX PE=3 SV=2 1 229 1.0E-18
sp|P76421|YEGX_ECOLI Uncharacterized protein YegX OS=Escherichia coli (strain K12) GN=yegX PE=3 SV=2 1 229 1.0E-17
sp|Q8X7H0|YEGX_ECO57 Uncharacterized protein YegX OS=Escherichia coli O157:H7 GN=yegX PE=3 SV=2 1 229 9.0E-17
sp|P26836|LYS_CLOPE Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) GN=lyc PE=3 SV=2 19 184 8.0E-16
sp|P34020|LYS_CLOAB Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lyc PE=1 SV=1 26 211 3.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0016998 cell wall macromolecule catabolic process Yes
GO:0009253 peptidoglycan catabolic process Yes
GO:0003796 lysozyme activity Yes
GO:1901575 organic substance catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0030203 glycosaminoglycan metabolic process No
GO:0008152 metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044248 cellular catabolic process No
GO:0061783 peptidoglycan muralytic activity No
GO:0006026 aminoglycan catabolic process No
GO:0016787 hydrolase activity No
GO:0006022 aminoglycan metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0006807 nitrogen compound metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0000270 peptidoglycan metabolic process No
GO:0003674 molecular_function No
GO:0044036 cell wall macromolecule metabolic process No
GO:1901136 carbohydrate derivative catabolic process No
GO:0009987 cellular process No
GO:0006027 glycosaminoglycan catabolic process No
GO:0003824 catalytic activity No
GO:0044265 cellular macromolecule catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044237 cellular metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|108530
MKFFSLLCLSTIAIATPLGSRQSQPQGIDVSGFQPNVDFNQVKANGISFAFIKATEGTTFRSDTFSNQYTGATNA
GIIRGAYHFAHPDSSSGAAQANFFIDNGGGWTNDGITLPGALDIEYNPNGPECYGLSASAMVSWAKDFSNTYKAR
TGRAPVIYSTTDWWTTCTGNSADFAENPLWIARFASSIGTLPAGWDFATFWQFANSGPNPGDQDLFNGDADGLKR
MATGS*
Coding >AgabiH97|108530
ATGAAGTTCTTCTCCCTCCTTTGCTTGAGTACCATCGCTATTGCAACACCTCTCGGGAGTAGGCAATCCCAGCCT
CAGGGGATTGATGTCTCGGGTTTCCAACCGAACGTCGATTTTAATCAGGTTAAAGCGAATGGCATTTCATTCGCG
TTCATTAAAGCGACTGAAGGCACTACCTTTAGGAGCGACACATTCAGTAATCAATATACTGGAGCAACTAATGCT
GGGATCATTCGCGGAGCATACCATTTTGCGCACCCCGATAGTTCTTCCGGTGCTGCACAAGCCAACTTCTTCATC
GATAATGGAGGCGGGTGGACCAATGACGGAATCACTCTCCCTGGTGCCCTTGATATTGAATATAACCCAAATGGG
CCCGAGTGCTATGGTCTGAGCGCATCCGCGATGGTTTCCTGGGCCAAGGACTTCTCCAACACATACAAGGCCAGG
ACGGGGCGTGCTCCCGTTATCTATTCCACTACAGATTGGTGGACAACCTGTACTGGGAACAGTGCTGATTTCGCG
GAAAACCCATTGTGGATCGCTCGTTTCGCGTCAAGCATTGGTACTCTTCCTGCTGGATGGGACTTCGCCACCTTC
TGGCAATTTGCAAACTCAGGACCTAATCCCGGCGACCAAGACCTTTTCAATGGTGATGCCGATGGCTTGAAGCGT
ATGGCAACTGGATCTTAA
Transcript >AgabiH97|108530
ATGAAGTTCTTCTCCCTCCTTTGCTTGAGTACCATCGCTATTGCAACACCTCTCGGGAGTAGGCAATCCCAGCCT
CAGGGGATTGATGTCTCGGGTTTCCAACCGAACGTCGATTTTAATCAGGTTAAAGCGAATGGCATTTCATTCGCG
TTCATTAAAGCGACTGAAGGCACTACCTTTAGGAGCGACACATTCAGTAATCAATATACTGGAGCAACTAATGCT
GGGATCATTCGCGGAGCATACCATTTTGCGCACCCCGATAGTTCTTCCGGTGCTGCACAAGCCAACTTCTTCATC
GATAATGGAGGCGGGTGGACCAATGACGGAATCACTCTCCCTGGTGCCCTTGATATTGAATATAACCCAAATGGG
CCCGAGTGCTATGGTCTGAGCGCATCCGCGATGGTTTCCTGGGCCAAGGACTTCTCCAACACATACAAGGCCAGG
ACGGGGCGTGCTCCCGTTATCTATTCCACTACAGATTGGTGGACAACCTGTACTGGGAACAGTGCTGATTTCGCG
GAAAACCCATTGTGGATCGCTCGTTTCGCGTCAAGCATTGGTACTCTTCCTGCTGGATGGGACTTCGCCACCTTC
TGGCAATTTGCAAACTCAGGACCTAATCCCGGCGACCAAGACCTTTTCAATGGTGATGCCGATGGCTTGAAGCGT
ATGGCAACTGGATCTTAA
Gene >AgabiH97|108530
ATGAAGTTCTTCTCCCTCCTTTGCTTGAGTACCATCGCTATTGCAACACCTCTCGGGAGTAGGCAATCCCAGCCT
CAGGGGATTGATGTCTCGGGTTTCCAACCGAACGTCGATTTTAATCAGGTTAAAGCGAATGGCATTTCATTCGCG
TTCATTAAAGCGACTGAAGGCACTAGTAAGTGATCACAAGAATACGTTGAAACGTATTGCAACATCTCTCGTTTA
GCCTTTAGGAGCGACACATTCAGTAATCAATATACTGGAGCAACTAATGCTGGGATCATTCGCGGAGCATACCAT
TTTGCGCACCCCGATAGTTCTTCCGGTGCTGCACAAGCCAACTTCTTCATCGATAATGGAGGTGTGTCAGCCATT
TATTCGATTTCGGGTGAGCTTGGACTAAAAGCTTCCAGGCGGGTGGACCAATGACGGTAAGTTATATCTTGACCT
TGAATGGAAGGTCAGGATTCAATTCTGAGTAGGAATCACTCTCCCTGGTGCCCTTGATATTGAATGTAAGTTGCG
CTGAATAAGATAAAAAGGCAGCGACTTTACTCGTTCAAAAAAAAAAACCAGATAACCCAAATGGGCCCGAGTGCT
ATGGTCTGAGCGCATCCGCGATGGTTTCCTGGGCCAAGGACTTCTCCAACACATACAAGGCCAGGACGGGGCGGT
AAGTCAAAAAGCAAAATTCACTGCTTACGCAAAATCTCATAGACGGTAATCGTTTAGTGCTCCCGTTATCTATTC
CACTACAGATTGGTGGACAACCTGTACTGGGAACAGTGCTGATTTCGCGGAAAACCCATTGTGGATCGCTCGTTT
CGCGTCAAGCATTGGTACTCTTCCTGCTGGATGGGAGTAAGTCCAATGTGAACCTCCATGCCTAATGCCTAGGAA
GTCTTACCACCCGTCATAGCTTCGCCACCTTCTGGCAATTTGCAAACTCAGGACCTAATCCCGGCGACCAAGACC
TTTTCAATGGTGATGCCGATGGCTTGAAGCGGTAAGTTGGACAGTAAAGTTACTAATCAGGTTATTGACCAGCTT
TGGCACAACTAGTATGGCAACTGGATCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail