Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|108080
Gene name
Locationscaffold_8:473986..474928
Strand-
Gene length (bp)942
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08284 RVP_2 Retroviral aspartyl protease 2.1E-09 34 133
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 3.0E-07 32 117
PF13650 Asp_protease_2 Aspartyl protease 5.0E-06 31 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86TG7|PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens GN=PEG10 PE=1 SV=2 8 282 1.0E-09
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 218 278 9.0E-09
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 218 278 1.0E-08
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 30 273 6.0E-08
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 30 273 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86TG7|PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens GN=PEG10 PE=1 SV=2 8 282 1.0E-09
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 218 278 9.0E-09
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 218 278 1.0E-08
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 30 273 6.0E-08
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 30 273 6.0E-08
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 30 273 6.0E-08
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 30 273 6.0E-08
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 30 273 6.0E-08
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 30 273 6.0E-08
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 30 273 6.0E-08
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 30 273 6.0E-08
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 30 273 6.0E-08
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 30 273 6.0E-08
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 108 279 8.0E-08
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 30 273 9.0E-08
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 17 278 2.0E-07
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 17 278 6.0E-07
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 17 278 4.0E-06
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 17 278 4.0E-06
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus GN=Peg10 PE=1 SV=2 8 133 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|108080
MNNRYVVPQKRLGVQELEVKPLLTTTNRKKLKVSAMVDSGCTHTCIDEGLVKKKKIPTKKLERLITCRNSDGTIA
GKKDITKFAKIDLNINGHNEQLDAVVTPLQSSDLFLGHDWLTNHNPEINWKQGMIKFNRCPTSCSFPHTDISFEP
RIRRLQSNEDTEEKEPDPTNPEDLPAYMKPFAHLFNRKNFDKLPERTEWDHEINFTENAPTEISSKVYSMTPLER
EELDKFLDENLATNRIRPSKSPYAAPCFFVPKKDGSLRLCQDYRKLNEITIKDKTVRTLPECHGVTLSHLSHILL
HNNFPLLLQFDGG*
Coding >AgabiH97|108080
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACCACA
ACAAACAGAAAGAAACTCAAAGTCTCAGCCATGGTCGACTCGGGATGCACACACACATGTATCGACGAAGGATTA
GTAAAGAAGAAGAAAATCCCAACGAAGAAATTGGAACGGCTGATCACATGCAGGAACTCAGATGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAACGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCATTACAATCCTCCGACCTCTTTCTAGGTCATGATTGGTTAACGAACCACAACCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGACGATTACAGTCAAACGAAGACACTGAGGAAAAAGAACCGGATCCAACGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTCGCCCATCTTTTCAACAGAAAGAACTTCGACAAACTGCCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTGGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAGAAAGACGGTTCACTACGGTTATGTCAGGATTATAGGAAACTGAACGAAATCACG
ATCAAAGACAAGACTGTTAGAACTTTGCCAGAATGTCACGGCGTCACGCTGTCACATCTGTCACACATTTTATTA
CATAATAATTTCCCTCTGCTGCTACAGTTCGACGGAGGCTAA
Transcript >AgabiH97|108080
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACCACA
ACAAACAGAAAGAAACTCAAAGTCTCAGCCATGGTCGACTCGGGATGCACACACACATGTATCGACGAAGGATTA
GTAAAGAAGAAGAAAATCCCAACGAAGAAATTGGAACGGCTGATCACATGCAGGAACTCAGATGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAACGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCATTACAATCCTCCGACCTCTTTCTAGGTCATGATTGGTTAACGAACCACAACCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGACGATTACAGTCAAACGAAGACACTGAGGAAAAAGAACCGGATCCAACGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTCGCCCATCTTTTCAACAGAAAGAACTTCGACAAACTGCCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTGGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAGAAAGACGGTTCACTACGGTTATGTCAGGATTATAGGAAACTGAACGAAATCACG
ATCAAAGACAAGACTGTTAGAACTTTGCCAGAATGTCACGGCGTCACGCTGTCACATCTGTCACACATTTTATTA
CATAATAATTTCCCTCTGCTGCTACAGTTCGACGGAGGCTAA
Gene >AgabiH97|108080
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACCACA
ACAAACAGAAAGAAACTCAAAGTCTCAGCCATGGTCGACTCGGGATGCACACACACATGTATCGACGAAGGATTA
GTAAAGAAGAAGAAAATCCCAACGAAGAAATTGGAACGGCTGATCACATGCAGGAACTCAGATGGAACGATAGCA
GGAAAGAAGGATATCACCAAATTCGCGAAGATAGATCTAAACATCAACGGTCATAACGAGCAACTGGACGCGGTC
GTCACTCCATTACAATCCTCCGACCTCTTTCTAGGTCATGATTGGTTAACGAACCACAACCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
CGTATACGACGATTACAGTCAAACGAAGACACTGAGGAAAAAGAACCGGATCCAACGAACCCTGAGGACTTACCA
GCATACATGAAACCCTTCGCCCATCTTTTCAACAGAAAGAACTTCGACAAACTGCCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTGGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAGAAAGACGGTTCACTACGGTTATGTCAGGATTATAGGAAACTGAACGAAATCACG
ATCAAAGACAAGACTGTTAGAACTTTGCCAGAATGTCACGGCGTCACGCTGTCACATCTGTCACACATTTTATTA
CATAATAATTTCCCTCTGCTGCTACAGTTCGACGGAGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail