Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|107310
Gene name
Locationscaffold_8:265760..266372
Strand-
Gene length (bp)612
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 9.4E-10 16 126

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.4917 0.4749 0.3233 0.135 0.0299 0.024 0.1307 0.1218 0.0582 0.0007

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup7727
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|374800
Agaricus bisporus var bisporus H39 AgabiH39|440900
Agaricus bisporus var bisporus H39 AgabiH39|547200
Agaricus bisporus var bisporus H97 AgabiH97|039240
Agaricus bisporus var bisporus H97 AgabiH97|060580
Agaricus bisporus var bisporus H97 AgabiH97|107290
Agaricus bisporus var bisporus H97 AgabiH97|107300
Agaricus bisporus var bisporus H97 AgabiH97|107310 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|107310
MINARTTNGLIPIRFENAHDLWKMLKDTYGIAGPSAIYSMFQQTGNFRISGAKEPSAEIAQLEQIYSQLTSNNVE
IPPLVQAMTLLGSIPEQWKIASSFLAAKGDVKDVTFHAVRSAILQEYNQRQTANNSQAHRFSGVKQGNQKPAWRP
YKGQQQQQQRPYNNGPHQKPIADAPARAATTTTAKWSAPKEESTWEEKPPTGE*
Coding >AgabiH97|107310
ATGATCAATGCTCGTACCACCAACGGTCTCATCCCCATTAGGTTTGAGAACGCTCACGATCTCTGGAAGATGCTC
AAGGACACTTATGGTATAGCTGGTCCATCGGCTATCTACTCCATGTTTCAACAAACCGGGAATTTCCGTATCTCG
GGTGCTAAAGAACCCTCAGCTGAGATCGCCCAATTGGAGCAGATCTATAGTCAGCTGACTAGTAATAATGTCGAG
ATTCCACCTCTCGTTCAAGCAATGACGCTGCTCGGATCAATTCCTGAGCAATGGAAAATTGCTTCTTCATTCCTT
GCCGCTAAGGGTGACGTCAAAGATGTCACCTTTCATGCAGTCCGCTCCGCTATTCTTCAAGAATACAATCAGCGT
CAGACTGCTAATAATTCCCAAGCGCATCGATTCTCTGGCGTCAAACAAGGCAATCAAAAGCCTGCTTGGCGACCA
TATAAAGGGCAGCAGCAGCAGCAGCAGAGGCCATATAACAATGGCCCTCACCAAAAACCAATCGCAGATGCGCCC
GCAAGGGCAGCAACAACAACAACAGCGAAGTGGTCCGCCCCCAAAGAAGAATCGACGTGGGAAGAAAAACCACCA
ACAGGTGAATGA
Transcript >AgabiH97|107310
ATGATCAATGCTCGTACCACCAACGGTCTCATCCCCATTAGGTTTGAGAACGCTCACGATCTCTGGAAGATGCTC
AAGGACACTTATGGTATAGCTGGTCCATCGGCTATCTACTCCATGTTTCAACAAACCGGGAATTTCCGTATCTCG
GGTGCTAAAGAACCCTCAGCTGAGATCGCCCAATTGGAGCAGATCTATAGTCAGCTGACTAGTAATAATGTCGAG
ATTCCACCTCTCGTTCAAGCAATGACGCTGCTCGGATCAATTCCTGAGCAATGGAAAATTGCTTCTTCATTCCTT
GCCGCTAAGGGTGACGTCAAAGATGTCACCTTTCATGCAGTCCGCTCCGCTATTCTTCAAGAATACAATCAGCGT
CAGACTGCTAATAATTCCCAAGCGCATCGATTCTCTGGCGTCAAACAAGGCAATCAAAAGCCTGCTTGGCGACCA
TATAAAGGGCAGCAGCAGCAGCAGCAGAGGCCATATAACAATGGCCCTCACCAAAAACCAATCGCAGATGCGCCC
GCAAGGGCAGCAACAACAACAACAGCGAAGTGGTCCGCCCCCAAAGAAGAATCGACGTGGGAAGAAAAACCACCA
ACAGGTGAATGA
Gene >AgabiH97|107310
ATGATCAATGCTCGTACCACCAACGGTCTCATCCCCATTAGGTTTGAGAACGCTCACGATCTCTGGAAGATGCTC
AAGGACACTTATGGTATAGCTGGTCCATCGGCTATCTACTCCATGTTTCAACAAACCGGGAATTTCCGTATCTCG
GGTGCTAAAGAACCCTCAGCTGAGATCGCCCAATTGGAGCAGATCTATAGTCAGCTGACTAGTAATAATGTCGAG
ATTCCACCTCTCGTTCAAGCAATGACGCTGCTCGGATCAATTCCTGAGCAATGGAAAATTGCTTCTTCATTCCTT
GCCGCTAAGGGTGACGTCAAAGATGTCACCTTTCATGCAGTCCGCTCCGCTATTCTTCAAGAATACAATCAGCGT
CAGACTGCTAATAATTCCCAAGCGCATCGATTCTCTGGCGTCAAACAAGGCAATCAAAAGCCTGCTTGGCGACCA
TATAAAGGGCAGCAGCAGCAGCAGCAGAGGCCATATAACAATGGCCCTCACCAAAAACCAATCGCAGATGCGCCC
GCAAGGGCAGCAACAACAACAACAGCGAAGTGGTCCGCCCCCAAAGAAGAATCGACGTGGGAAGAAAAACCACCA
ACAGGTGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail