Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|107310
Gene name
Locationscaffold_8:265760..266372
Strand-
Gene length (bp)612
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 9.4E-10 16 126

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|107310
MINARTTNGLIPIRFENAHDLWKMLKDTYGIAGPSAIYSMFQQTGNFRISGAKEPSAEIAQLEQIYSQLTSNNVE
IPPLVQAMTLLGSIPEQWKIASSFLAAKGDVKDVTFHAVRSAILQEYNQRQTANNSQAHRFSGVKQGNQKPAWRP
YKGQQQQQQRPYNNGPHQKPIADAPARAATTTTAKWSAPKEESTWEEKPPTGE*
Coding >AgabiH97|107310
ATGATCAATGCTCGTACCACCAACGGTCTCATCCCCATTAGGTTTGAGAACGCTCACGATCTCTGGAAGATGCTC
AAGGACACTTATGGTATAGCTGGTCCATCGGCTATCTACTCCATGTTTCAACAAACCGGGAATTTCCGTATCTCG
GGTGCTAAAGAACCCTCAGCTGAGATCGCCCAATTGGAGCAGATCTATAGTCAGCTGACTAGTAATAATGTCGAG
ATTCCACCTCTCGTTCAAGCAATGACGCTGCTCGGATCAATTCCTGAGCAATGGAAAATTGCTTCTTCATTCCTT
GCCGCTAAGGGTGACGTCAAAGATGTCACCTTTCATGCAGTCCGCTCCGCTATTCTTCAAGAATACAATCAGCGT
CAGACTGCTAATAATTCCCAAGCGCATCGATTCTCTGGCGTCAAACAAGGCAATCAAAAGCCTGCTTGGCGACCA
TATAAAGGGCAGCAGCAGCAGCAGCAGAGGCCATATAACAATGGCCCTCACCAAAAACCAATCGCAGATGCGCCC
GCAAGGGCAGCAACAACAACAACAGCGAAGTGGTCCGCCCCCAAAGAAGAATCGACGTGGGAAGAAAAACCACCA
ACAGGTGAATGA
Transcript >AgabiH97|107310
ATGATCAATGCTCGTACCACCAACGGTCTCATCCCCATTAGGTTTGAGAACGCTCACGATCTCTGGAAGATGCTC
AAGGACACTTATGGTATAGCTGGTCCATCGGCTATCTACTCCATGTTTCAACAAACCGGGAATTTCCGTATCTCG
GGTGCTAAAGAACCCTCAGCTGAGATCGCCCAATTGGAGCAGATCTATAGTCAGCTGACTAGTAATAATGTCGAG
ATTCCACCTCTCGTTCAAGCAATGACGCTGCTCGGATCAATTCCTGAGCAATGGAAAATTGCTTCTTCATTCCTT
GCCGCTAAGGGTGACGTCAAAGATGTCACCTTTCATGCAGTCCGCTCCGCTATTCTTCAAGAATACAATCAGCGT
CAGACTGCTAATAATTCCCAAGCGCATCGATTCTCTGGCGTCAAACAAGGCAATCAAAAGCCTGCTTGGCGACCA
TATAAAGGGCAGCAGCAGCAGCAGCAGAGGCCATATAACAATGGCCCTCACCAAAAACCAATCGCAGATGCGCCC
GCAAGGGCAGCAACAACAACAACAGCGAAGTGGTCCGCCCCCAAAGAAGAATCGACGTGGGAAGAAAAACCACCA
ACAGGTGAATGA
Gene >AgabiH97|107310
ATGATCAATGCTCGTACCACCAACGGTCTCATCCCCATTAGGTTTGAGAACGCTCACGATCTCTGGAAGATGCTC
AAGGACACTTATGGTATAGCTGGTCCATCGGCTATCTACTCCATGTTTCAACAAACCGGGAATTTCCGTATCTCG
GGTGCTAAAGAACCCTCAGCTGAGATCGCCCAATTGGAGCAGATCTATAGTCAGCTGACTAGTAATAATGTCGAG
ATTCCACCTCTCGTTCAAGCAATGACGCTGCTCGGATCAATTCCTGAGCAATGGAAAATTGCTTCTTCATTCCTT
GCCGCTAAGGGTGACGTCAAAGATGTCACCTTTCATGCAGTCCGCTCCGCTATTCTTCAAGAATACAATCAGCGT
CAGACTGCTAATAATTCCCAAGCGCATCGATTCTCTGGCGTCAAACAAGGCAATCAAAAGCCTGCTTGGCGACCA
TATAAAGGGCAGCAGCAGCAGCAGCAGAGGCCATATAACAATGGCCCTCACCAAAAACCAATCGCAGATGCGCCC
GCAAGGGCAGCAACAACAACAACAGCGAAGTGGTCCGCCCCCAAAGAAGAATCGACGTGGGAAGAAAAACCACCA
ACAGGTGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail