Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|106540
Gene name
Locationscaffold_8:66620..68358
Strand+
Gene length (bp)1738
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14075 UBN_AB Ubinuclein conserved middle domain 2.5E-31 320 459
PF08729 HUN HPC2 and ubinuclein domain 9.1E-12 189 236

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|106540
MLDGQLSVSPPARSSSTGASRPSSLAALMNPEPPPSESEAEAEAQAVADEYEVDVDDDEGDEGDSEGDEISAVVS
APVLLARPPSHSSLPSSVSAPPEPIPASSKPSSSAKPRSKKPRSPSPSPPPNLPAPPFTTIRLDIQLGGPDRYEV
DVSQMAKVSGQRPPTPPSRISVAKHVVSESEPDTDGGKRKKRRKNPATEYYDVHDPFIDDSELALDERTYFAQTK
QQGFYVSSGEVALLKDKTPKKPKSKNIISLASAINATNGSAVKQATDKEEVLSGAVESSTKPGDEQGDETVGQKR
KRYITVVENGKKRKVVDQSSFHPELQASIEHLKEAIKAENWSQKGKFPPNLKTQLSNLALQAIKLDEYDEHFFSL
MPVLFPYNKFTMTKLIKRTVFADHTKLLHDRQEELLKELKALTDEGFQKAEEEWEKSVLAWDRRQEKAKHDQTDS
AAPTRHPTEEMEQGWRWKGI*
Coding >AgabiH97|106540
ATGCTCGATGGCCAGCTCTCTGTGTCTCCGCCGGCCCGCTCAAGTTCCACCGGCGCGAGTCGTCCCTCGTCGCTC
GCCGCGTTGATGAACCCCGAGCCGCCCCCCAGCGAGTCGGAGGCCGAGGCCGAGGCTCAAGCCGTTGCCGACGAG
TACGAGGTCGATGTGGACGACGATGAGGGCGACGAGGGCGACAGCGAGGGCGACGAAATCTCTGCAGTGGTCTCG
GCCCCTGTCCTACTTGCTCGTCCCCCTTCTCATTCCAGCTTGCCTTCCTCTGTTTCTGCCCCGCCAGAGCCTATT
CCTGCCTCTTCAAAGCCTTCCTCTTCAGCCAAACCCCGCTCAAAAAAACCCAGATCACCGTCACCGTCGCCCCCT
CCTAACCTCCCAGCTCCGCCATTCACTACTATCCGATTAGATATTCAACTCGGCGGTCCAGATAGATATGAAGTC
GATGTATCGCAGATGGCCAAAGTCTCGGGTCAACGACCGCCCACACCTCCGTCAAGAATTTCCGTCGCTAAGCAT
GTTGTCAGTGAGAGCGAACCGGATACTGATGGTGGCAAGCGGAAGAAACGTCGAAAGAATCCTGCAACAGAATAT
TATGATGTCCATGACCCTTTCATAGACGATTCCGAACTTGCACTCGACGAGCGGACGTACTTTGCCCAAACAAAG
CAGCAGGGCTTCTATGTCTCCAGTGGAGAGGTTGCGCTTCTCAAAGACAAGACTCCCAAGAAACCCAAGTCAAAG
AATATAATTTCACTCGCCTCAGCCATCAATGCCACTAACGGATCTGCTGTCAAACAAGCAACGGACAAGGAAGAA
GTCCTTAGTGGCGCAGTCGAATCTAGTACAAAACCCGGAGATGAACAAGGCGACGAGACTGTTGGGCAAAAACGG
AAACGGTATATCACCGTCGTCGAGAACGGAAAGAAGCGGAAAGTTGTCGATCAGTCGTCCTTCCATCCTGAGCTA
CAAGCATCTATCGAACATTTGAAAGAAGCTATTAAAGCTGAAAATTGGTCTCAGAAAGGCAAATTTCCCCCAAAT
CTCAAAACGCAGCTCTCAAACCTCGCCTTACAAGCAATTAAACTCGACGAATACGATGAACATTTCTTCAGTCTC
ATGCCCGTTCTATTTCCTTACAACAAATTCACAATGACCAAGTTAATCAAGAGAACGGTATTTGCGGATCATACG
AAATTACTTCATGATAGGCAAGAGGAGCTTTTAAAAGAGCTCAAGGCGCTCACCGATGAAGGATTTCAGAAGGCC
GAAGAGGAGTGGGAGAAGAGTGTTTTAGCTTGGGATCGACGTCAGGAGAAGGCGAAGCACGATCAAACCGATTCT
GCGGCTCCTACGCGTCATCCAACAGAAGAAATGGAACAAGGATGGAGGTGGAAAGGAATCTAA
Transcript >AgabiH97|106540
ATGCTCGATGGCCAGCTCTCTGTGTCTCCGCCGGCCCGCTCAAGTTCCACCGGCGCGAGTCGTCCCTCGTCGCTC
GCCGCGTTGATGAACCCCGAGCCGCCCCCCAGCGAGTCGGAGGCCGAGGCCGAGGCTCAAGCCGTTGCCGACGAG
TACGAGGTCGATGTGGACGACGATGAGGGCGACGAGGGCGACAGCGAGGGCGACGAAATCTCTGCAGTGGTCTCG
GCCCCTGTCCTACTTGCTCGTCCCCCTTCTCATTCCAGCTTGCCTTCCTCTGTTTCTGCCCCGCCAGAGCCTATT
CCTGCCTCTTCAAAGCCTTCCTCTTCAGCCAAACCCCGCTCAAAAAAACCCAGATCACCGTCACCGTCGCCCCCT
CCTAACCTCCCAGCTCCGCCATTCACTACTATCCGATTAGATATTCAACTCGGCGGTCCAGATAGATATGAAGTC
GATGTATCGCAGATGGCCAAAGTCTCGGGTCAACGACCGCCCACACCTCCGTCAAGAATTTCCGTCGCTAAGCAT
GTTGTCAGTGAGAGCGAACCGGATACTGATGGTGGCAAGCGGAAGAAACGTCGAAAGAATCCTGCAACAGAATAT
TATGATGTCCATGACCCTTTCATAGACGATTCCGAACTTGCACTCGACGAGCGGACGTACTTTGCCCAAACAAAG
CAGCAGGGCTTCTATGTCTCCAGTGGAGAGGTTGCGCTTCTCAAAGACAAGACTCCCAAGAAACCCAAGTCAAAG
AATATAATTTCACTCGCCTCAGCCATCAATGCCACTAACGGATCTGCTGTCAAACAAGCAACGGACAAGGAAGAA
GTCCTTAGTGGCGCAGTCGAATCTAGTACAAAACCCGGAGATGAACAAGGCGACGAGACTGTTGGGCAAAAACGG
AAACGGTATATCACCGTCGTCGAGAACGGAAAGAAGCGGAAAGTTGTCGATCAGTCGTCCTTCCATCCTGAGCTA
CAAGCATCTATCGAACATTTGAAAGAAGCTATTAAAGCTGAAAATTGGTCTCAGAAAGGCAAATTTCCCCCAAAT
CTCAAAACGCAGCTCTCAAACCTCGCCTTACAAGCAATTAAACTCGACGAATACGATGAACATTTCTTCAGTCTC
ATGCCCGTTCTATTTCCTTACAACAAATTCACAATGACCAAGTTAATCAAGAGAACGGTATTTGCGGATCATACG
AAATTACTTCATGATAGGCAAGAGGAGCTTTTAAAAGAGCTCAAGGCGCTCACCGATGAAGGATTTCAGAAGGCC
GAAGAGGAGTGGGAGAAGAGTGTTTTAGCTTGGGATCGACGTCAGGAGAAGGCGAAGCACGATCAAACCGATTCT
GCGGCTCCTACGCGTCATCCAACAGAAGAAATGGAACAAGGATGGAGGTGGAAAGGAATCTAA
Gene >AgabiH97|106540
ATGCTCGATGGCCAGCTCTCTGTGTCTCCGCCGGCCCGCTCAAGTTCCACCGGCGCGAGTCGTCCCTCGTCGCTC
GCCGCGTTGATGAACCCCGAGCCGCCCCCCAGCGAGTCGGAGGCCGAGGCCGAGGCTCAAGCCGTTGCCGACGAG
TACGAGGTCGATGTGGACGACGATGAGGGCGACGAGGGCGACAGCGAGGGCGACGAAATCTCTGCAGTGGTCTCG
GCCCCTGTCCTACTTGCTCGTCCCCCTTCTCATTCCAGCTTGCCTTCCTCTGTTTCTGCCCCGCCAGAGCCTATT
CCTGCCTCTTCAAAGCCTTCCTCTTCAGCCAAACCCCGCTCAAAAAAACCCAGATCACCGTCACCGTCGCCCCCT
CCTAACCTCCCAGCTCCGCCATTCACTACTATCCGATTAGATATTCAACTCGGCGGTCCAGATAGATATGAAGTC
GATGTATCGCAGATGGCCAAAGTCTCGGGTCAACGACCGCCCACACCTCCGTCAAGAATTTCCGTCGCTAAGCAT
GTTGTCAGTGAGAGCGAACCGGATACTGATGGTGGCAAGCGGAAGAAACGTCGAGTAAGTGCTCGACATCTGATT
GACTTCTTACCATCCTCATAACCACGCTGCATAGAAGAATCCTGCAACAGAATATTATGATGTCCATGACCCTTT
CATAGACGATTCCGAACTTGCACTCGACGAGCGGACGTACTTTGCCCAAACAAAGCAGCAGGGCTTCTATGTCTC
CAGTGGAGAGGTTGCGCTTCTCAAAGACAAGCGAGTTGTCGATTATTTTCATAGGCCTGAAATCTCCCTCTGACC
GTCCATACCAGGACTCCCAAGAAACCCAAGTCAAAGAATATAATTTCACTCGCCTCAGCCATCAATGCCACTAAC
GGATCTGCTGTCAAACAAGCAACGGACAAGGAAGAAGTCCTTAGTGGCGCAGTCGAATCTAGTACAAAACCCGGA
GATGAACAAGGCGACGAGACTGTTGGGCAAAAACGGAAACGGTATATCACCGTCGTCGAGAACGGAAAGAAGCGG
AAAGTTGTCGATCAGGTAAATATTCGTACTCTTCATACTCCCCATCCTTCTTACCAATATCTCCAGTCGTCCTTC
CATCCTGAGCTACAAGCATCTATCGAACATTTGAAAGAAGCTATTAAAGCTGGTGAGTATGTTCGTCTCCCGTTC
ATCATTCTTTGTTTCCTCACTCCATTATCAGAAAATTGGTCTCAGAAAGGCAAATTTCCCCCAAATCTCAAAACG
CAGCTCTCAAACCTCGCCTTACAAGCAATTAAACTCGACGAATACGATGAACATTTCTTCAGTCTCATGCCCGTT
CTATTTCCTTACAACAAATTCACAATGACCAAGTTAATCAAGAGAACGGTATTTGCGGATCATACGAAATTACTT
CATGATAGGCAAGAGGAGCTTTTAAAAGAGCTCAAGGCGCTCACCGATGAAGGATTTCAGAAGGCCGAAGAGGAG
TGGGAGAAGAGTGTTTTAGCTTGGGGTTATTTTTTTCGGCTACCTTGCCTTGTTGCGTACGGGCGCTGATAACAA
TGTACCTTATAGATCGACGTCAGGAGAAGGCGAAGCACGATCAAACCGATTCTGCGGCTCCTACGCGTCATCCAA
CAGAAGAAATGGAAGTGGACGGAGTTAGTACCGTAGCAGGTCAACAACCAGACGCTGAAAGCAAGGATGGAGGTG
GAAAGGAATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail