Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|106530
Gene name
Locationscaffold_8:64626..66520
Strand-
Gene length (bp)1894
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.0E-13 36 270

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08280|BSC6_YEAST Bypass of stop codon protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BSC6 PE=1 SV=1 43 402 5.0E-29

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 77 96 19
3 100 119 19
4 139 161 22
5 166 188 22
6 226 248 22
7 258 280 22
8 287 305 18
9 309 331 22
10 338 360 22
11 375 397 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|106530
MPELELESLSHRKTHPDEDIEIKKRPGNRKIQRRFSLPLCAGDVYHVGFTIVSLIFIFACLGFVSGALANVHLTD
RLGFGKTIILGAALQIIAYTIQSPAPPFPVFVMAYTINGVGIALQDAQANGFVASLRNNSETKMGLLHAAYGAGA
LASPLVATQFSQLRQWSFHFLVSLGIAVSNIIILYIVFGFKTQDECLRLLGQEVSEKNEDEQSSFKQILRVKAVH
FLAFFILVYVGVEVTIGGWIVTFMLDVRGGGPSSGYVSSGFFGGLMLGRVLLLWVNKKIGERLVLFLYAFLAIGL
ELVIWFVPSLIGGAVAVSIVGLLLGPMYPVAMNHAGRVLPNWLLTGSIGWIAGFGQAGSAALPFITGVISSKHGI
RSLQPLLIAMMGCMMILWYLVPSKRHD*
Coding >AgabiH97|106530
ATGCCAGAGCTAGAACTCGAATCTCTCTCGCACCGTAAAACACACCCAGATGAAGATATTGAAATAAAGAAAAGA
CCAGGAAACAGAAAAATACAGAGAAGATTCAGTTTGCCGCTCTGTGCTGGTGACGTTTATCATGTCGGATTTACC
ATCGTATCCTTGATCTTCATATTTGCCTGTCTGGGCTTTGTTTCTGGTGCTCTCGCAAACGTACACCTCACTGAC
CGTTTGGGATTTGGCAAGACAATCATTCTCGGTGCTGCGCTGCAAATCATTGCATACACAATCCAATCGCCAGCA
CCCCCCTTCCCTGTGTTTGTGATGGCATATACTATCAATGGTGTTGGCATCGCTCTCCAGGATGCTCAGGCCAAT
GGCTTCGTTGCCAGCCTGAGAAACAACTCGGAAACCAAGATGGGTCTCCTACATGCTGCTTATGGCGCCGGTGCC
CTAGCCTCACCCCTCGTTGCGACTCAGTTCTCACAACTTCGTCAATGGTCCTTCCACTTTCTCGTATCCCTCGGC
ATTGCAGTCTCCAACATCATCATCCTCTATATCGTCTTTGGGTTTAAAACACAAGATGAGTGCCTTCGGCTTCTT
GGACAAGAAGTATCGGAAAAGAACGAAGATGAACAATCCTCATTCAAACAGATCCTTCGCGTTAAAGCCGTACAT
TTTCTCGCATTCTTCATTCTTGTCTACGTTGGCGTCGAAGTCACCATCGGAGGGTGGATTGTTACATTTATGCTC
GACGTCCGTGGTGGCGGACCGTCCTCGGGCTACGTTTCATCTGGTTTCTTTGGTGGCCTGATGCTTGGTCGAGTC
CTCCTACTCTGGGTCAACAAAAAGATCGGTGAACGCCTAGTTTTATTCCTCTATGCATTCCTTGCCATCGGGCTC
GAACTCGTGATTTGGTTTGTTCCTTCCCTTATCGGAGGAGCAGTCGCCGTCTCCATCGTCGGTCTCCTTCTCGGA
CCCATGTATCCGGTCGCCATGAATCACGCAGGCCGCGTCCTTCCGAACTGGTTACTCACGGGCTCTATTGGTTGG
ATAGCGGGATTCGGTCAAGCAGGAAGCGCAGCTCTTCCTTTCATCACTGGTGTAATTTCTTCAAAACATGGCATT
CGGAGTCTCCAACCATTACTGATTGCAATGATGGGTTGCATGATGATCTTGTGGTATCTCGTACCATCCAAAAGA
CATGACTAA
Transcript >AgabiH97|106530
ATGCCAGAGCTAGAACTCGAATCTCTCTCGCACCGTAAAACACACCCAGATGAAGATATTGAAATAAAGAAAAGA
CCAGGAAACAGAAAAATACAGAGAAGATTCAGTTTGCCGCTCTGTGCTGGTGACGTTTATCATGTCGGATTTACC
ATCGTATCCTTGATCTTCATATTTGCCTGTCTGGGCTTTGTTTCTGGTGCTCTCGCAAACGTACACCTCACTGAC
CGTTTGGGATTTGGCAAGACAATCATTCTCGGTGCTGCGCTGCAAATCATTGCATACACAATCCAATCGCCAGCA
CCCCCCTTCCCTGTGTTTGTGATGGCATATACTATCAATGGTGTTGGCATCGCTCTCCAGGATGCTCAGGCCAAT
GGCTTCGTTGCCAGCCTGAGAAACAACTCGGAAACCAAGATGGGTCTCCTACATGCTGCTTATGGCGCCGGTGCC
CTAGCCTCACCCCTCGTTGCGACTCAGTTCTCACAACTTCGTCAATGGTCCTTCCACTTTCTCGTATCCCTCGGC
ATTGCAGTCTCCAACATCATCATCCTCTATATCGTCTTTGGGTTTAAAACACAAGATGAGTGCCTTCGGCTTCTT
GGACAAGAAGTATCGGAAAAGAACGAAGATGAACAATCCTCATTCAAACAGATCCTTCGCGTTAAAGCCGTACAT
TTTCTCGCATTCTTCATTCTTGTCTACGTTGGCGTCGAAGTCACCATCGGAGGGTGGATTGTTACATTTATGCTC
GACGTCCGTGGTGGCGGACCGTCCTCGGGCTACGTTTCATCTGGTTTCTTTGGTGGCCTGATGCTTGGTCGAGTC
CTCCTACTCTGGGTCAACAAAAAGATCGGTGAACGCCTAGTTTTATTCCTCTATGCATTCCTTGCCATCGGGCTC
GAACTCGTGATTTGGTTTGTTCCTTCCCTTATCGGAGGAGCAGTCGCCGTCTCCATCGTCGGTCTCCTTCTCGGA
CCCATGTATCCGGTCGCCATGAATCACGCAGGCCGCGTCCTTCCGAACTGGTTACTCACGGGCTCTATTGGTTGG
ATAGCGGGATTCGGTCAAGCAGGAAGCGCAGCTCTTCCTTTCATCACTGGTGTAATTTCTTCAAAACATGGCATT
CGGAGTCTCCAACCATTACTGATTGCAATGATGGGTTGCATGATGATCTTGTGGTATCTCGTACCATCCAAAAGA
CATGACTAA
Gene >AgabiH97|106530
ATGCCAGAGCTAGAACTCGAATCTCTCTCGCACCGTAAAACACACCCAGATGAAGATATTGAAATAAAGAAAAGT
GATGATGCTGTGGAAGATCCTATTCACCAAGCTCTGACCGACAACAGGACCAGGAAACAGAAAAATACAGAGAAG
ATTCAGTTTGCCGCTCTGTGCTGGTGTCTCTTCCTTGCTGGATGGAACGATGGGTCAACTGGTCCTTTACTGCCT
CGGATACAGGACGTTTATCATGTGCATCTCACCCAGCCCCGTAACTGCGTTCAACTAACCTACACACGCAGGTCG
GATTTACCATCGTATCCTTGATCTTCATATTTGCCTGTCTGGTCAGTCGTCTCTCGTTTCTTTATTCTGTCTATC
GCTTCACGAGTTACAGGGCTTTGTTTCTGGTGCTCTCGCAAACGTACACCTCACTGACCGTTTGGGATTTGGCAA
GGTCTGTACTCCACCGTGCTCCAGATATACTTGATTTACAATATACTTGAACAGACAATCATTCTCGGTAAAATG
CCTATTCATCGTCCCTTTGAATATCGACTTTTAAACGAAAAACATTCCAGGTGCTGCGCTGCAAATCATTGCATA
CACAATCCAATCGCCAGCACCCCCCTTCCCTGTGTTTGTGATGGCATATACTATCAATGGTGTTGGCATCGCTCT
CCAGGTACATAGCATGCTCCCATGAACACCGGAAACTCACGATACTGTATGTAACAGGATGCTCAGGCCAATGGC
TTCGTTGCCAGCCTGAGAAACAACTCGGAAACCAAGATGGGTCTCCTACATGCTGCTTATGGTGACCTACTACGT
AACCTCACAGACGCGCCATTTAACCTCTCTTTCACAGGCGCCGGTGCCCTAGCCTCACCCCTCGTTGCGACTCAG
TTCTCACAACTTCGTCAATGGTCCTTCCACTTTCTCGTATCCCTCGGCATTGCAGTCTCCAACATCATCATCCTC
TATATCGTCTTTGGGTTTAAAACACAAGATGGTAAGCTCCGCTTAACTCACCATCCATAAAAATTCCTACTTATC
TGTTATCAGAGTGCCTTCGGCTTCTTGGACAAGAAGTATCGGAAAAGAACGAAGATGAACAATCCTCATTCAAAC
AGATCCTTCGCGTTAAAGCCGTACATTTTCTCGCATTCTTCATTCTTGTCTACGTTGGCGTCGAAGTCACCATCG
GAGGGTGGATTGTTACATTTATGCTCGACGTCCGTGGTGGCGGACCGTCCTCGGGCTACGTTTCATCTGGTTTCT
TTGGTGGTAAGACATCGCTCCATCCACTCTAGTTTCAACATTCACGCAATTCGAAAGGCCTGATGCTTGGTCGAG
TCCTCCTACTCTGGGTCAACAAAAAGGTACGCTGTCTCGTGCAAGTCATTGCTTGACTCCTCACGAAATATACCC
AGATCGGTGAACGCCTAGTTTTATTCCTCTATGCATTCCTTGCCATCGGGTAATTCATGTCATTATCCCACCAAT
ACATAGAATAGCCTAACCGTTCTGCCAGGCTCGAACTCGTGATTTGGTTTGTTCCTTCCCTTATCGGAGGAGCAG
TCGCCGTCTCCATCGTCGGTCTCCTTCTCGGACCCATGTATCCGGTCGCCATGAATCACGCAGGCCGCGTCCTTC
CGAACTGGTTACTCACGGGCTCTATTGGTTGGATAGCGGGATTCGGTCAAGCAGGAAGCGCAGCTCTTCCTTTCA
TCACTGGTGTAATTTCTTCAAAACATGGCATTCGGAGTCTCCAACCATTGTGAGTGTTATCTGTGAAAATAACCG
GCGTGATCTGTAACCTTGTCTCCCCAGACTGATTGCAATGATGGGTTGCATGATGATCTTGTGGTATCTCGTACC
ATCCAAAAGACATGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail